KEGG   Methylobacterium populi: Mpop_0706Help
Entry
Mpop_0706         CDS       T00760                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpo  Methylobacterium populi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mpop_0706
Enzymes [BR:mpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mpop_0706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
750028..750756
Genome map
AA seq 242 aa AA seqDB search
MGDEGMRIWVSRPEPGAGRTARRLAERGHAALVAPVLRIAPSDGPPPAGPFDGLILTSAN
AAAPLAGAGLPAAPVFAVGARTAERAARAGLHPVLCADGDAADLARLVAAHVRPGGVLLH
AAGEDRKAEPAARLTAEGYRVTTWTAYAALAETALPEAAARALRDRDGAPPLTAALHFSR
RSAEIAAHLCREAGLSGAFRALAHYCLSADVAAGLVELGVAAHFVAARPSEEALLAGLAA
SD
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgggggacgagggcatgcggatctgggtgtcgcggcccgagccgggcgcgggacgcacg
gcgcggcggctggccgaacgcggccacgcggcgctcgtggcacccgtgttgcggatcgcg
ccgagcgacgggccgccgcccgccggccctttcgacgggctgatcctcacgagcgccaac
gccgccgcgccgctcgccggcgcgggccttcccgccgcgccggtcttcgccgtcggtgcc
cgcacggcggagcgggcggcgcgggccggccttcacccggtcctctgcgccgacggggat
gccgccgacctggcccggctcgtcgcggcgcatgtgcggccggggggcgtcctcctccac
gccgcgggcgaggaccgcaaggcggagcccgcggcgcgtctcacggccgagggttaccgc
gtcacgacctggaccgcctacgccgccctggccgagacggccctgcccgaggcggcggcg
cgggcgctccgcgatcgggatggcgccccccccctcacggcagccttgcacttctcccgg
cgcagcgccgaaatcgccgcgcatttgtgccgtgaggcgggactgagcggagcgtttcgg
gcgctggcgcattactgcctgtccgcggacgtcgccgcgggactggtcgagctcggcgtt
gcggcccattttgtggcggcgcggccgagcgaggaggctctcctcgccggtctcgcggct
tcggactga

DBGET integrated database retrieval system