KEGG   Methylobacterium populi: Mpop_0773Help
Entry
Mpop_0773         CDS       T00760                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mpo  Methylobacterium populi
Pathway
mpo00521  Streptomycin biosynthesis
mpo00523  Polyketide sugar unit biosynthesis
mpo01130  Biosynthesis of antibiotics
Module
mpo_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Mpop_0773
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mpop_0773
Enzymes [BR:mpo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Mpop_0773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACB78951
JGI: Mpop0773
UniProt: B1Z7Y0
Position
832417..832950
Genome map
AA seq 177 aa AA seqDB search
MIFEELALPGLFRVAPEPHADERGFFARTHCEETFTARGLVGRFAQSSVSFNHRRGTVRG
MHFSRAPHAETKLVRCTAGAIHDAVIDLRPDSPTYRRTAAVRLSAANRHALYIPAGLAHG
FQTLSDDAEILYMIDLPFVASAADGVRWDDPAFALTWPEPVSVISDRDRAFPDWVGR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcgaggaactcgcgctgccgggcctgttccgcgtcgcgcccgagccccacgcc
gacgagcgcggcttcttcgcccgcactcattgcgaggagacgttcaccgcgcgcgggctg
gtcggacgcttcgcgcagtcgagcgtgtcgttcaaccatcgccgcggcaccgtgcgcggg
atgcatttctcaagggcgccccatgccgagacgaagctcgtgcgctgcaccgccggggcg
atccacgacgcggtgatcgacctgcggcccgactcgccgacctatcgccgcaccgcggcc
gtgaggctctcggccgccaaccgccacgccctctacatcccggcaggcctcgcccacggc
tttcagacgctgagcgacgacgccgagatcctctacatgatcgaccttcccttcgtggcc
tccgccgccgacggcgtgcgctgggacgaccccgcctttgctctcacctggcccgagccg
gtgagcgtgatctcggaccgcgaccgcgcctttcccgattgggtgggacggtga

DBGET integrated database retrieval system