KEGG   Methylobacterium populi: Mpop_0860Help
Entry
Mpop_0860         CDS       T00760                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
mpo  Methylobacterium populi
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mpo00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mpo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
913462..913824
Genome map
AA seq 120 aa AA seqDB search
MRHLILGAAFALLLPVAAQAEGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEG
ADGYAFSDALKKSGITWDEANLKEWLTDPKKKVPGTKMVFPGIKDPKKVDDIIAYLKTKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcctcggcgccgcattcgcgctgcttctgcctgtcgccgcccaagcc
gagggcgatgccgccgccggcgagaaggcgttcgccccctgcaaggcctgccacaacttc
gagaagaacggcgtcggcccgaccctgaagggcgttgtcggcgcgaaggccggtgagggt
gccgacggctacgccttctccgatgcgctgaagaagtccggcatcacctgggacgaggcc
aacctcaaggagtggctcaccgacccgaagaagaaggtgcccggcaccaagatggtcttc
cccggcatcaaggacccgaagaaggtcgacgacatcatcgcctacctcaagaccaagtcc
tga

DBGET integrated database retrieval system