KEGG   Methylobacterium populi: Mpop_0860Help
Entry
Mpop_0860         CDS       T00760                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
mpo  Methylobacterium populi
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mpop_0860
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mpop_0860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
913462..913824
Genome map
AA seq 120 aa AA seqDB search
MRHLILGAAFALLLPVAAQAEGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEG
ADGYAFSDALKKSGITWDEANLKEWLTDPKKKVPGTKMVFPGIKDPKKVDDIIAYLKTKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcctcggcgccgcattcgcgctgcttctgcctgtcgccgcccaagcc
gagggcgatgccgccgccggcgagaaggcgttcgccccctgcaaggcctgccacaacttc
gagaagaacggcgtcggcccgaccctgaagggcgttgtcggcgcgaaggccggtgagggt
gccgacggctacgccttctccgatgcgctgaagaagtccggcatcacctgggacgaggcc
aacctcaaggagtggctcaccgacccgaagaagaaggtgcccggcaccaagatggtcttc
cccggcatcaaggacccgaagaaggtcgacgacatcatcgcctacctcaagaccaagtcc
tga

DBGET integrated database retrieval system