KEGG   Methylobacterium populi: Mpop_1188Help
Entry
Mpop_1188         CDS       T00760                                 

Definition
1-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
mpo  Methylobacterium populi
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mpop_1188
Enzymes [BR:mpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     Mpop_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1268538..1269485
Genome map
AA seq 315 aa AA seqDB search
MRLVTLTLNPAIDQTVTLDALTPGSVHRARSVWSDAGGKGVNVACCLADWGLAIAATGVL
GQDNAAPFAQLLAAKSIDDRFVWIPGETRTNLKLLDASGGDTTDINLPGLEFGPSTVEAV
RAVLADLTGPGSLAVLAGSLPRSLGPDIYARLTAELKRRGARVVLDASGPALAAALAAGR
DSLPDAIKPNRHELEEWAGRPLPTLADVLDAAHHLQRSGIALVCVSLGAEGALFVSSEGA
LRALPPPTRVASTVGAGDALVAGLVAGLHDGLALPDLARRALAFAAGKLSRTGANLPPRA
EVEAIAAEIQVERLG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcgtcaccctcaccctcaacccggcgatcgaccagaccgtcaccctcgacgcg
ctcacgcccggcagcgttcatcgcgcccgctcggtctggtcggatgccggcggaaagggc
gtcaacgtcgcctgctgcctcgccgattgggggttggcgatcgccgccaccggcgtgctc
ggccaggacaacgccgcccccttcgcgcagcttctggcggccaagagcatcgacgaccgc
ttcgtctggatccccggcgagacgcgcaccaacctcaagctgctcgatgcatcgggcggc
gacaccaccgacatcaacctgcccgggctcgaattcggcccgtccaccgtcgaggcggtg
cgcgccgtgctcgccgacctcaccggccccggcagcctcgcggtgctcgccggcagcctg
ccgcgttctctcggccccgacatctatgcccgcctcaccgccgagctgaagcggcgcggc
gcccgcgtcgtcctcgacgcctccggcccggcgctggccgccgccctcgcggcggggcgc
gacagcctgcccgacgcgatcaagccgaaccggcacgagctggaggaatgggccgggcgc
ccgcttcccacgctcgcggacgtgctcgacgccgcccaccatcttcagcgcagcggcatc
gccctggtctgcgtctcgctgggtgccgagggcgcgctgttcgtctcgtcggagggggcg
ttgcgggcgctgccgccgccgacgcgggtggcgagcacggtgggtgcgggcgacgccctc
gtcgccggcctcgtcgccggactgcatgacggcttggccctgcccgacctcgcccgccgg
gcgctggccttcgccgcaggcaagctcagccgcacgggggcgaacctgccgccgcgggcg
gaggtggaggcgatcgccgccgagatccaggtcgagcggctcggctga

DBGET integrated database retrieval system