KEGG   Methylobacterium populi: Mpop_1276Help
Entry
Mpop_1276         CDS       T00760                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpo  Methylobacterium populi
Pathway
mpo00071  Fatty acid degradation
mpo00280  Valine, leucine and isoleucine degradation
mpo00281  Geraniol degradation
mpo00310  Lysine degradation
mpo00360  Phenylalanine metabolism
mpo00362  Benzoate degradation
mpo00380  Tryptophan metabolism
mpo00410  beta-Alanine metabolism
mpo00627  Aminobenzoate degradation
mpo00640  Propanoate metabolism
mpo00650  Butanoate metabolism
mpo00903  Limonene and pinene degradation
mpo00930  Caprolactam degradation
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mpop_1276
   00650 Butanoate metabolism
    Mpop_1276
  Lipid metabolism
   00071 Fatty acid degradation
    Mpop_1276
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mpop_1276
   00310 Lysine degradation
    Mpop_1276
   00360 Phenylalanine metabolism
    Mpop_1276
   00380 Tryptophan metabolism
    Mpop_1276
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mpop_1276
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mpop_1276
   00281 Geraniol degradation
    Mpop_1276
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mpop_1276
   00627 Aminobenzoate degradation
    Mpop_1276
   00930 Caprolactam degradation
    Mpop_1276
Enzymes [BR:mpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mpop_1276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ACB79447
JGI: Mpop1276
UniProt: B1ZCT5
Position
complement(1370471..1371244)
Genome map
AA seq 257 aa AA seqDB search
MSYETILTETRGRVLLITLNRPKALNAINRQLTAELIDAATRADADPGIGCIVVTGSERA
FAAGADVKEMQAASYADMFAGDRFADWERFTALRTPVIAAVAGFALGGGCELAMMCDFIL
AADTAQFGQPEIKLGIMPGIGGSQRLTRFVGKSKAMEMCLTGRTMDAAEAERAGLVSRVV
PAAELAAEAMKAAETIAAMSLPIAMMTKEAVNRAYETTLTEGVRFERRVFHAMFATEDQK
EGMAAFVEKRPPRFSNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgagacgatcctcaccgagacgcgcggacgcgtcctcctcatcaccctgaac
cggccgaaggcgctcaacgccatcaaccggcagctcaccgccgagctgatcgacgccgcg
acgcgggccgacgccgatccggggatcggctgcatcgtcgtcaccggctccgagcgcgcc
ttcgccgcgggcgccgacgtcaaggagatgcaggcggcctcctacgccgacatgttcgcg
ggcgaccgcttcgccgactgggagcgcttcacggcgctgcgtaccccggtcatcgccgcg
gtggccggcttcgccctcggcggcggctgcgaactcgccatgatgtgcgacttcatcctc
gccgccgacacggcgcagttcggccagccggagatcaagctcggcatcatgcccggcatc
ggcggcagccagcggctgacccgcttcgtcggcaagtcgaaggcgatggagatgtgcctg
accggccggaccatggatgcggccgaggccgagcgcgccggcctcgtctcgcgggtggtg
ccggcggccgaactcgccgccgaggcgatgaaggcggccgagaccatcgcggcgatgtcc
ctgcccatcgccatgatgaccaaggaggcggtcaaccgcgcctacgagacgacgctcacc
gagggcgtgcgcttcgagcggcgcgtcttccacgcgatgttcgccaccgaggaccagaag
gagggcatggccgccttcgtcgagaagcgcccgccccgcttctccaaccgctga

DBGET integrated database retrieval system