KEGG   Methylobacterium populi: Mpop_1297Help
Entry
Mpop_1297         CDS       T00760                                 

Definition
(GenBank) MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mpo  Methylobacterium populi
Pathway
mpo02020  Two-component system
mpo02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mpop_1297
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Mpop_1297
Enzymes [BR:mpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Mpop_1297
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Mpop_1297
Two-component system [BR:mpo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Mpop_1297
Bacterial motility proteins [BR:mpo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Mpop_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR PAS_10 CheB_methylest PAS_4 HWE_HK PAS_3 CheR_N PAS CENP-F_leu_zip IncA Golgin_A5 PAS_8 DUF3450 HATPase_c_2 APG6 HAP1_N AAA_23 Fez1 PAS_7 DUF16 OmpH Methyltransf_12 Spectrin FapA HOOK DUF4407 Spc7 Atg14 AAA_13 Fmp27_WPPW DUF3584 Mnd1 TMF_TATA_bd HMMR_N EzrA ATG16 AAA_11 FH2 DUF812 Acetyltransf_1 IFT57 Snapin_Pallidin KASH_CCD Seryl_tRNA_N NBP1 zf-C4H2 HemX RasGAP_C Exonuc_VII_L LMBR1 CC2-LZ DUF2203
Motif
Other DBs
NCBI-ProteinID: ACB79468
JGI: Mpop1297
UniProt: B1ZCV6
Position
complement(1395374..1398880)
Genome map
AA seq 1168 aa AA seqDB search
MVKSSEEAVAEDGKPVVVALCASAANTRSLVHLLQQLPARPDTAIIVVLQHRETLDAADF
GHALEAAGHELNVVAQDMPLAPGRLYLPDPNVIVSVEGDHFRVRPAEQRFGERGTIDSFL
VSLLGETDGRTISVVLAGTGSDGTLGFKAVKEMGGIALAEETEESRSGELAASNIPAALA
DAVLPIDQLAGRIEASIRQLRSKSVADPRLQGAASSAVRATITSVLRNKTGHDFHGYKEG
TFMRRVQRRMQVAQIDDSAAYVEYLRAQPGEAQELFNDLLIGVTQFFRDTKEFELLEHTV
IPKLFEGKTRSDQLRIWIIGCSTGEEAYSFGILLREYMATLEEVPQVQIFATDLDGRALA
AARAARYAESVVRDVSPERLARWFVREGNTYCIVKEVREMCIFSQHSIIKDPPFSRLDLI
SCRNLLIYLDAELQSRVIPVFHFALKPEGVLFLGNSENVSRHTNLFAPIEPRSRIFRRLE
THSRILPDFPFAVASPRLENRPAASLPARVVEPSLARRAERFVERYTPAYVIVDETYTVL
HFSGRTRRYIDPAGGAASLNLLQLVHPDLRLDLRSALVRAAEEERTVHLANRRIEQESED
HLVDLVVEPVKETSAPTRNFFVLFKDGGSAAADPSATLASSQDQRDRIQQLETELRENKD
RLQAVAEEAESTNEELKASNEEYQSLNEELQSANEELQTSKEELQSVNEELTTVNGELGL
RVQELGRINSDLKNFLESTQIATVFLDNDLRVMRFTPASAELFHLVESDAGRPLAHIKSR
IAYDELQEDARRVLRTLNSSEREIENPQSGTRYMVRVLPYRSVDNFIAGVVITFVDITAR
KQAEAALRESEERFRQFADASADVLWIRNARTLEFEYVGPAFEALYGAALGSFGQDHLRS
WLKLISPKDRKAVIDSFRRVRAGARVSQTFRIRRPSDGEELWLANASFPLFDDRGQVHRI
GGIASDVTEAKRAAERQDVLVKELQHRSRNLLGVVTSLATRTVGQGAPVESFTTRLNALG
RAQALLSRSGNDTVEVNALVHAELAAYTSGAAQRIKISGPRVLLTSEQVQNFALALHELT
TNAVKYGALKDETGSLSVTWERVTNSGQDKRMALNWIESGVSIAPHFLSRRGYGRELIEN
ALAYALQGRTEYVLGLDGLRCRIELPLK
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtcctccgaagaagcggtcgccgaggacggcaaacccgtcgtcgtcgccctg
tgcgcgtcggctgcgaatacgcgctcgctcgtccaccttctgcagcagctcccggcccgg
cccgacacggccatcatcgtcgtgctgcagcaccgggagacgctcgatgcggccgatttc
ggacacgccctcgaagccgccggccacgaactgaacgtcgtcgcgcaggacatgccgctc
gcgcccggccggctctacctgcccgacccgaacgtcatcgtcagcgtcgaaggcgatcac
ttccgggttcgtcccgccgagcagcggttcggcgaacggggaacgatcgacagcttcctc
gtctcgctgctgggcgagacggacggacgcaccatctccgtcgtcctcgccggaaccggc
tccgacggcaccctcggcttcaaggccgtgaaggagatgggcggcatcgcgctggccgag
gagacggaggagtcgcgctccggtgaactcgccgcgagcaacatccccgccgcgctggcg
gatgcggtgctgccgatcgaccaactggccgggcggatcgaggcgagcatccgccagctc
cgttcgaagtctgtggcggacccgcgcctccagggagccgcttcctcggcggtgcgggcg
acgatcacctcggtgctgcgcaacaagaccggccacgacttccacggctacaaggaaggc
accttcatgcgccgcgtccagcggcggatgcaggtcgcgcagatcgacgacagcgccgcc
tatgtcgagtatctgcgcgcgcagccgggggaggcgcaggaactcttcaacgaccttctg
atcggcgtgacgcagttcttccgcgatacgaaggagttcgagcttctcgaacataccgtc
atcccgaagctgttcgaggggaagacccgcagtgaccagctcaggatctggatcatcggc
tgctcgaccggcgaggaggcctactccttcggcatcctgctgcgcgagtacatggcgacc
ctggaggaggtgccgcaggtccagatcttcgcgaccgatctcgacggcagggcgctcgcg
gcggcgcgggcggcgcgctacgcggaatcggtcgtgcgcgacgtcagccccgagcggctg
gcgcgctggttcgtgcgggagggcaacacctactgcatcgtcaaggaagtgcgggagatg
tgcatcttctcgcagcacagcatcatcaaggacccgcccttttcccgcctcgacctcatc
tcctgccgcaacctgctgatctatctcgatgccgagctgcagagccgcgtcatccccgtc
ttccatttcgccctgaagccggagggcgtgctgttcctcggcaattccgagaacgtctcc
cggcacaccaacctgttcgccccgatcgagccgcgctcgcgcatcttccgccgcctggag
acgcacagccggatcctgcccgacttccccttcgccgtggcctcgccgcggctcgagaac
cgcccggcggcgagcctgcccgcgcgcgtcgtcgagccgtcgctggcccggcgggccgag
cggttcgtggaacgctacacgccggcctacgtgatcgtggacgagacctacacggtgctg
cacttctccggccggaccaggcgctacatcgatccggccggcggcgcggcctcgctcaac
ctgctgcagctggtgcatccggacctgcgcctcgacctgcgctcggcgctcgtgcgcgcg
gccgaggaggagcggacggtccacctcgccaaccggcgcatcgagcaggagagcgaagac
catctggtcgatctcgtggtcgagccggtgaaggagacgtccgcgcccacgcgcaacttc
ttcgtgctgttcaaggacggagggtccgccgccgccgacccgagcgcgaccttggcctcg
tcccaggatcagcgcgaccgcatccagcagctcgaaaccgaattgcgggagaacaaggac
cggctccaggccgtcgccgaggaggcggagagcacgaacgaggagctgaaggcctccaac
gaggaataccagtcgctgaacgaggaactgcaatcggccaacgaggaattgcagacctcg
aaggaggagctgcaatcggtcaacgaggagctcaccaccgtcaacggcgaactcggcctg
cgcgtgcaggaactcggccgcatcaacagcgacctcaagaacttcctcgaaagcacgcag
atcgccaccgtcttcctcgacaacgacctgcgcgtcatgcgcttcaccccggcctcggcg
gagctgttccacctcgtcgaatcggatgcaggccggccgctcgcccacatcaagtcgcgc
atcgcctacgacgagctgcaggaggacgcccgccgcgtcctgcgcacgctgaacagctcc
gagcgcgagatcgagaacccgcagtccggtacgcgctacatggtgcgcgtgctgccctat
cgcagcgtcgacaacttcatcgccggcgtcgtcatcaccttcgtcgacatcaccgcgcgc
aagcaggccgaggcggccctgcgcgagagcgaggagcgcttccgccagttcgcggacgcc
tccgccgacgtcctctggatccggaacgcgcggacgctggaattcgagtatgtcgggccg
gccttcgaggcgctgtacggcgccgccctcggcagcttcggacaggatcatctgcgatcc
tggctgaagctcatctcacccaaggaccgcaaggcggtcatcgacagcttccgccgggtg
cgggcgggggcgcgggtgtcccagaccttccgcatccgccggccgagcgacggcgaggag
ctgtggctcgccaatgccagcttcccgctgttcgacgacagggggcaggtgcatcgcatc
ggcggcatcgcctccgacgtcacggaggccaagcgggccgccgagcgccaggacgtgctc
gtcaaggagctgcagcaccgctcgcgcaacctcctcggcgtggtcacctcgctcgcgacc
cgcaccgtcgggcagggggcgccggtcgagagcttcaccacgcggctgaacgccctcggg
cgcgctcaggccctcctgagccgatcgggcaacgacaccgtcgaggtcaacgccctcgtt
catgcggaactggcggcctatacctccggcgcggcccagcgcatcaagatctcgggcccg
cgggtgctgctgacctcggagcaggtccagaacttcgccctggccctgcacgaactgacc
accaacgcggtcaagtacggcgcgctgaaggacgagaccgggtcgctctccgtgacctgg
gagcgcgtgacgaacagcggccaggacaagcgcatggcgctgaactggatcgagagcggc
gtcagcatcgcgccgcatttcctgagccggcgcggctacgggcgcgagctgatcgagaat
gcgctcgcctatgccctgcagggccggaccgaatacgttctcggcctcgacggcctgcgc
tgccggatcgagctgccgttgaagtag

DBGET integrated database retrieval system