KEGG   Methylobacterium populi: Mpop_1297Help
Entry
Mpop_1297         CDS       T00760                                 

Definition
MCP methyltransferase/methylesterase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
mpo  Methylobacterium populi
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mpo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mpo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1395374..1398880)
Genome map
AA seq 1168 aa AA seqDB search
MVKSSEEAVAEDGKPVVVALCASAANTRSLVHLLQQLPARPDTAIIVVLQHRETLDAADF
GHALEAAGHELNVVAQDMPLAPGRLYLPDPNVIVSVEGDHFRVRPAEQRFGERGTIDSFL
VSLLGETDGRTISVVLAGTGSDGTLGFKAVKEMGGIALAEETEESRSGELAASNIPAALA
DAVLPIDQLAGRIEASIRQLRSKSVADPRLQGAASSAVRATITSVLRNKTGHDFHGYKEG
TFMRRVQRRMQVAQIDDSAAYVEYLRAQPGEAQELFNDLLIGVTQFFRDTKEFELLEHTV
IPKLFEGKTRSDQLRIWIIGCSTGEEAYSFGILLREYMATLEEVPQVQIFATDLDGRALA
AARAARYAESVVRDVSPERLARWFVREGNTYCIVKEVREMCIFSQHSIIKDPPFSRLDLI
SCRNLLIYLDAELQSRVIPVFHFALKPEGVLFLGNSENVSRHTNLFAPIEPRSRIFRRLE
THSRILPDFPFAVASPRLENRPAASLPARVVEPSLARRAERFVERYTPAYVIVDETYTVL
HFSGRTRRYIDPAGGAASLNLLQLVHPDLRLDLRSALVRAAEEERTVHLANRRIEQESED
HLVDLVVEPVKETSAPTRNFFVLFKDGGSAAADPSATLASSQDQRDRIQQLETELRENKD
RLQAVAEEAESTNEELKASNEEYQSLNEELQSANEELQTSKEELQSVNEELTTVNGELGL
RVQELGRINSDLKNFLESTQIATVFLDNDLRVMRFTPASAELFHLVESDAGRPLAHIKSR
IAYDELQEDARRVLRTLNSSEREIENPQSGTRYMVRVLPYRSVDNFIAGVVITFVDITAR
KQAEAALRESEERFRQFADASADVLWIRNARTLEFEYVGPAFEALYGAALGSFGQDHLRS
WLKLISPKDRKAVIDSFRRVRAGARVSQTFRIRRPSDGEELWLANASFPLFDDRGQVHRI
GGIASDVTEAKRAAERQDVLVKELQHRSRNLLGVVTSLATRTVGQGAPVESFTTRLNALG
RAQALLSRSGNDTVEVNALVHAELAAYTSGAAQRIKISGPRVLLTSEQVQNFALALHELT
TNAVKYGALKDETGSLSVTWERVTNSGQDKRMALNWIESGVSIAPHFLSRRGYGRELIEN
ALAYALQGRTEYVLGLDGLRCRIELPLK
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagtcctccgaagaagcggtcgccgaggacggcaaacccgtcgtcgtcgccctg
tgcgcgtcggctgcgaatacgcgctcgctcgtccaccttctgcagcagctcccggcccgg
cccgacacggccatcatcgtcgtgctgcagcaccgggagacgctcgatgcggccgatttc
ggacacgccctcgaagccgccggccacgaactgaacgtcgtcgcgcaggacatgccgctc
gcgcccggccggctctacctgcccgacccgaacgtcatcgtcagcgtcgaaggcgatcac
ttccgggttcgtcccgccgagcagcggttcggcgaacggggaacgatcgacagcttcctc
gtctcgctgctgggcgagacggacggacgcaccatctccgtcgtcctcgccggaaccggc
tccgacggcaccctcggcttcaaggccgtgaaggagatgggcggcatcgcgctggccgag
gagacggaggagtcgcgctccggtgaactcgccgcgagcaacatccccgccgcgctggcg
gatgcggtgctgccgatcgaccaactggccgggcggatcgaggcgagcatccgccagctc
cgttcgaagtctgtggcggacccgcgcctccagggagccgcttcctcggcggtgcgggcg
acgatcacctcggtgctgcgcaacaagaccggccacgacttccacggctacaaggaaggc
accttcatgcgccgcgtccagcggcggatgcaggtcgcgcagatcgacgacagcgccgcc
tatgtcgagtatctgcgcgcgcagccgggggaggcgcaggaactcttcaacgaccttctg
atcggcgtgacgcagttcttccgcgatacgaaggagttcgagcttctcgaacataccgtc
atcccgaagctgttcgaggggaagacccgcagtgaccagctcaggatctggatcatcggc
tgctcgaccggcgaggaggcctactccttcggcatcctgctgcgcgagtacatggcgacc
ctggaggaggtgccgcaggtccagatcttcgcgaccgatctcgacggcagggcgctcgcg
gcggcgcgggcggcgcgctacgcggaatcggtcgtgcgcgacgtcagccccgagcggctg
gcgcgctggttcgtgcgggagggcaacacctactgcatcgtcaaggaagtgcgggagatg
tgcatcttctcgcagcacagcatcatcaaggacccgcccttttcccgcctcgacctcatc
tcctgccgcaacctgctgatctatctcgatgccgagctgcagagccgcgtcatccccgtc
ttccatttcgccctgaagccggagggcgtgctgttcctcggcaattccgagaacgtctcc
cggcacaccaacctgttcgccccgatcgagccgcgctcgcgcatcttccgccgcctggag
acgcacagccggatcctgcccgacttccccttcgccgtggcctcgccgcggctcgagaac
cgcccggcggcgagcctgcccgcgcgcgtcgtcgagccgtcgctggcccggcgggccgag
cggttcgtggaacgctacacgccggcctacgtgatcgtggacgagacctacacggtgctg
cacttctccggccggaccaggcgctacatcgatccggccggcggcgcggcctcgctcaac
ctgctgcagctggtgcatccggacctgcgcctcgacctgcgctcggcgctcgtgcgcgcg
gccgaggaggagcggacggtccacctcgccaaccggcgcatcgagcaggagagcgaagac
catctggtcgatctcgtggtcgagccggtgaaggagacgtccgcgcccacgcgcaacttc
ttcgtgctgttcaaggacggagggtccgccgccgccgacccgagcgcgaccttggcctcg
tcccaggatcagcgcgaccgcatccagcagctcgaaaccgaattgcgggagaacaaggac
cggctccaggccgtcgccgaggaggcggagagcacgaacgaggagctgaaggcctccaac
gaggaataccagtcgctgaacgaggaactgcaatcggccaacgaggaattgcagacctcg
aaggaggagctgcaatcggtcaacgaggagctcaccaccgtcaacggcgaactcggcctg
cgcgtgcaggaactcggccgcatcaacagcgacctcaagaacttcctcgaaagcacgcag
atcgccaccgtcttcctcgacaacgacctgcgcgtcatgcgcttcaccccggcctcggcg
gagctgttccacctcgtcgaatcggatgcaggccggccgctcgcccacatcaagtcgcgc
atcgcctacgacgagctgcaggaggacgcccgccgcgtcctgcgcacgctgaacagctcc
gagcgcgagatcgagaacccgcagtccggtacgcgctacatggtgcgcgtgctgccctat
cgcagcgtcgacaacttcatcgccggcgtcgtcatcaccttcgtcgacatcaccgcgcgc
aagcaggccgaggcggccctgcgcgagagcgaggagcgcttccgccagttcgcggacgcc
tccgccgacgtcctctggatccggaacgcgcggacgctggaattcgagtatgtcgggccg
gccttcgaggcgctgtacggcgccgccctcggcagcttcggacaggatcatctgcgatcc
tggctgaagctcatctcacccaaggaccgcaaggcggtcatcgacagcttccgccgggtg
cgggcgggggcgcgggtgtcccagaccttccgcatccgccggccgagcgacggcgaggag
ctgtggctcgccaatgccagcttcccgctgttcgacgacagggggcaggtgcatcgcatc
ggcggcatcgcctccgacgtcacggaggccaagcgggccgccgagcgccaggacgtgctc
gtcaaggagctgcagcaccgctcgcgcaacctcctcggcgtggtcacctcgctcgcgacc
cgcaccgtcgggcagggggcgccggtcgagagcttcaccacgcggctgaacgccctcggg
cgcgctcaggccctcctgagccgatcgggcaacgacaccgtcgaggtcaacgccctcgtt
catgcggaactggcggcctatacctccggcgcggcccagcgcatcaagatctcgggcccg
cgggtgctgctgacctcggagcaggtccagaacttcgccctggccctgcacgaactgacc
accaacgcggtcaagtacggcgcgctgaaggacgagaccgggtcgctctccgtgacctgg
gagcgcgtgacgaacagcggccaggacaagcgcatggcgctgaactggatcgagagcggc
gtcagcatcgcgccgcatttcctgagccggcgcggctacgggcgcgagctgatcgagaat
gcgctcgcctatgccctgcagggccggaccgaatacgttctcggcctcgacggcctgcgc
tgccggatcgagctgccgttgaagtag

DBGET integrated database retrieval system