KEGG   Methylobacterium populi: Mpop_1314Help
Entry
Mpop_1314         CDS       T00760                                 

Definition
cellulase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mpo  Methylobacterium populi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mpop_1314
Enzymes [BR:mpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mpop_1314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1421899..1423164
Genome map
AA seq 421 aa AA seqDB search
MRPPRTPCRSRLGGTLRRAGWALALAAASPAAAQPTPQPAAPQPASPQQTSPQMAQPAPQ
QTETSTVPPATALPGLPRSETPARTDSGPSLANTLDDDAAWRAYRARFITEQGRIVDTAN
GMISHSEGQGYGMLIAVAAGDRAAFERIWGWTRANLMVRSDELLAWRWAPDHRPAVADMN
NATDGDILVAWALTEAAEAWGEPSYRTAARRIAVEFGRKTILFKDPHGPLLLPAVSGFSA
RERADGPLINLSYWVFPAFQRLPIVAPEYDWASLIRSGLDFLRQSRFGPSSLPTEWISAK
DSLRPADGFPPLFSYNAIRVPLYLAWAGVGRPEDYTPFKTLWGGIERERLPIVDTRDGQP
VEWLSEVGYTAIPALTACAADGTPFPESLRTVQENQNYYPMTLHLLALIAARMRYPSCVK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccccccgcacgccgtgccgttcccgcctcggcggcaccctgcgccgcgccgga
tgggcgctcgcccttgcggcggccagccccgccgccgcccagccgacgccgcagccggcc
gcgccgcagcccgcatctccgcagcagacctcgccgcagatggcgcagccggctccccag
cagacggagaccagcaccgtgccgcccgccacggccctgcccggcctgccgcgctccgag
acgccggcccggaccgattccggcccttccctcgccaataccctggacgacgacgcggcc
tggcgcgcctaccgggcacggttcatcaccgagcagggccggatcgtcgacaccgccaac
ggcatgatcagccacagcgagggccagggctacggcatgctgatcgcggtcgcggccggc
gaccgggccgccttcgagcggatctggggctggacccgtgccaacctgatggtgcgctcc
gacgaattgctggcgtggcgctgggcgcccgaccaccgcccggcggtggcggacatgaac
aacgccaccgacggcgacatcctcgtcgcctgggcgctcaccgaggcggcggaggcctgg
ggcgagccgtcctaccgcaccgccgcgcgccgcatcgccgtcgagttcggtcgcaagacc
atcctgttcaaggacccccacggaccgctcctgctgcccgccgtctccggcttctcggcc
cgcgaacgcgccgacgggccgctcatcaacctgtcctactgggtcttccccgccttccag
cggctgccgatcgtcgccccggaatacgactgggcctcgctgatccgcagcggcctcgac
ttcctgcgccagtcccggttcgggccgagcagcctgccgaccgagtggatctcggccaag
gacagcctgcgccccgccgacggcttcccgccgctgttctcctacaacgcgatccgcgtg
ccgctctacctcgcctgggccggggtcggacggccggaggattacacgccgttcaagacg
ctgtggggcgggatcgagcgcgagcgcctgccgatcgtcgacacccgcgacgggcagccg
gtcgagtggctgagcgaggtcggctacacggcgatccccgcgctcaccgcctgcgccgcc
gacggcacgccgtttcccgaatcgttaagaacggtgcaggagaatcagaactactatccg
atgaccctccacctcctcgcgctgatcgcggcccggatgcggtatccgtcatgcgtgaag
tcctga

DBGET integrated database retrieval system