KEGG   Methylobacterium populi: Mpop_1412Help
Entry
Mpop_1412         CDS       T00760                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
mpo  Methylobacterium populi
Brite
Enzymes [BR:mpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Mpop_1412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1529628..1530257)
Genome map
AA seq 209 aa AA seqDB search
MDLSAVGRAVLIAREGRRLEAYRDSVGVWTIGIGHTAAAGPPIPRAGLRIDAAEADAIFA
RDVAAFVRTVAEALPEPLPQHAFDALVSLCFNIGPAAFRRSSVLRRLRAGDRLGAGEAIL
MWNRPAAIIPRRQGEFDQFRTPYEAALPRARRGDAQPVSTPVSAPVPAARPTVPPAARPS
WRARLRDWLARAALTASLRPDQDRSHDVH
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggacctcagtgccgtcggccgcgccgtgctgatcgcccgggaggggcgacggctggaa
gcctaccgcgacagcgtgggcgtctggaccatcggcatcggccacaccgccgccgccggg
ccgccgatcccgcgggccggcctgcgcatcgatgcggcggaggccgacgcgatcttcgcc
cgcgacgtggcggccttcgtccgcaccgtcgccgaggcgctccccgagccgctgccgcaa
cacgcgttcgacgcgctcgtctcactctgcttcaacatcggcccggcggccttccggcgc
tcctccgtgctgcgacgcctgcgggccggcgatcgcctgggtgcgggcgaagcgatcctg
atgtggaaccgccccgccgcgatcatcccccgccgccagggcgagttcgaccagttccgc
acgccctacgaggccgccctgccgcgggcccggcgcggcgacgcgcagcccgtctcgacc
cctgtctccgctccagtcccggccgcccgtcccaccgtgccgcccgcggcccgccccagc
tggcgcgcgcgcctgcgggactggctggcgcgcgccgcactgaccgcttccctccgcccc
gatcaggatcgctctcatgacgtccactga

DBGET integrated database retrieval system