KEGG   Methylobacterium populi: Mpop_1583Help
Entry
Mpop_1583         CDS       T00760                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mpo  Methylobacterium populi
Pathway
mpo00020  Citrate cycle (TCA cycle)
mpo00310  Lysine degradation
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01200  Carbon metabolism
Module
mpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpop_1583
  Amino acid metabolism
   00310 Lysine degradation
    Mpop_1583
Enzymes [BR:mpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mpop_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ACB79747
JGI: Mpop1583
UniProt: B1ZG89
Position
complement(1707575..1708912)
Genome map
AA seq 445 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL
VKDGETVEPGAVLGSIVEGGKGADKGAAKSESKSDSKPAPKSAEPAETKSESREEKGGKS
KDGPAQESSASYGSHGDAPPAGGGRGADESGPAVAKLARESGVDPSSLNGSGKDGRVTKG
DMLAAIDKGGAKAPAQETKAPAPPRAPSAPDDAAREERVRMTKLRQTIARRLKSAQDTAA
MLTTFNDVDMGAVMALRAQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQD
LVYKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKIAGFGKKAREGKLSIDEMQGGT
FTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRGGKIEARPMMYLALSYDHRIVD
GKEAVTFLVRVKEALEDPARLVLDL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgatatcctcgtccccacgctcggcgaatccgtcagtgaggccacgatcggc
cgctggttcaaaaagcccggcgacacggtggccgccgacgagccgttggtcgaactcgag
accgacaaggtcaccctcgaagtgaacgcccccgccgcgggcgaactcggcgagatcctc
gtcaaggacggcgagacggtcgagcccggcgcggtgctcggctcgatcgtcgagggcggc
aaaggcgccgacaagggtgcggcaaagtccgagtccaagtccgattccaagccggcgccg
aagagcgccgaaccggccgagaccaagagcgagagccgcgaggagaagggcggcaagtcc
aaggacggcccggcccaggaatcgtccgcttcctacggcagccacggcgatgccccgccg
gccggcggcgggcgcggcgccgacgagagcggcccggcggtcgccaagctcgcccgcgaa
agcggcgtcgatccgtcgagcctcaacggcagcggcaaggacggccgcgtgaccaagggc
gacatgctcgccgcgatcgacaagggcggcgcgaaggcgccggctcaggagaccaaggct
ccggctccgccgcgtgcgccttctgccccggacgacgccgcgcgcgaggagcgcgtgcgg
atgaccaagctgcgccagaccatcgcccggcgcctcaagagcgcccaggacacggcggcg
atgctgaccacgttcaacgacgtggacatgggtgcggtgatggcgctgcgcgcgcagtac
aaggacatcttcgagaagaagcacgggacgaagctcggcttcatgggcttcttcaccaag
gcggtgatcggcgcgctcaaggacgtgccggcggtcaatgccgagatcgacgggcaggat
ctcgtctacaagaactactaccacatcggcatcgccgtcggcaccgataagggcctcgtc
gtgccggtggtgcgcgacgccgacgacctgtcgatcgccggcatcgagaagaagatcgcc
ggcttcggcaagaaggcgcgcgagggcaagctctccatcgacgagatgcagggcggcacc
ttcaccatcaccaacggcggcatctacggctcgctgatgtcgaccccgatcctcaacgcg
ccgcaatcgggcatcctcggcatgcaccgcatcgaggagcggccggtggtgcgcgggggc
aagatcgaggcgcggccgatgatgtatctggcgctctcctacgatcaccgcatcgtcgac
gggaaggaggccgtgaccttcctcgtccgcgtcaaggaggcgctggaggatccggcccgc
ctcgtgctggatctctga

DBGET integrated database retrieval system