KEGG   Methylobacterium populi: Mpop_1583Help
Entry
Mpop_1583         CDS       T00760                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mpo  Methylobacterium populi
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpop_1583
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpop_1583
  Amino acid metabolism
   00310 Lysine degradation
    Mpop_1583
Enzymes [BR:mpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mpop_1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1707575..1708912)
Genome map
AA seq 445 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL
VKDGETVEPGAVLGSIVEGGKGADKGAAKSESKSDSKPAPKSAEPAETKSESREEKGGKS
KDGPAQESSASYGSHGDAPPAGGGRGADESGPAVAKLARESGVDPSSLNGSGKDGRVTKG
DMLAAIDKGGAKAPAQETKAPAPPRAPSAPDDAAREERVRMTKLRQTIARRLKSAQDTAA
MLTTFNDVDMGAVMALRAQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQD
LVYKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKIAGFGKKAREGKLSIDEMQGGT
FTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRGGKIEARPMMYLALSYDHRIVD
GKEAVTFLVRVKEALEDPARLVLDL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgatatcctcgtccccacgctcggcgaatccgtcagtgaggccacgatcggc
cgctggttcaaaaagcccggcgacacggtggccgccgacgagccgttggtcgaactcgag
accgacaaggtcaccctcgaagtgaacgcccccgccgcgggcgaactcggcgagatcctc
gtcaaggacggcgagacggtcgagcccggcgcggtgctcggctcgatcgtcgagggcggc
aaaggcgccgacaagggtgcggcaaagtccgagtccaagtccgattccaagccggcgccg
aagagcgccgaaccggccgagaccaagagcgagagccgcgaggagaagggcggcaagtcc
aaggacggcccggcccaggaatcgtccgcttcctacggcagccacggcgatgccccgccg
gccggcggcgggcgcggcgccgacgagagcggcccggcggtcgccaagctcgcccgcgaa
agcggcgtcgatccgtcgagcctcaacggcagcggcaaggacggccgcgtgaccaagggc
gacatgctcgccgcgatcgacaagggcggcgcgaaggcgccggctcaggagaccaaggct
ccggctccgccgcgtgcgccttctgccccggacgacgccgcgcgcgaggagcgcgtgcgg
atgaccaagctgcgccagaccatcgcccggcgcctcaagagcgcccaggacacggcggcg
atgctgaccacgttcaacgacgtggacatgggtgcggtgatggcgctgcgcgcgcagtac
aaggacatcttcgagaagaagcacgggacgaagctcggcttcatgggcttcttcaccaag
gcggtgatcggcgcgctcaaggacgtgccggcggtcaatgccgagatcgacgggcaggat
ctcgtctacaagaactactaccacatcggcatcgccgtcggcaccgataagggcctcgtc
gtgccggtggtgcgcgacgccgacgacctgtcgatcgccggcatcgagaagaagatcgcc
ggcttcggcaagaaggcgcgcgagggcaagctctccatcgacgagatgcagggcggcacc
ttcaccatcaccaacggcggcatctacggctcgctgatgtcgaccccgatcctcaacgcg
ccgcaatcgggcatcctcggcatgcaccgcatcgaggagcggccggtggtgcgcgggggc
aagatcgaggcgcggccgatgatgtatctggcgctctcctacgatcaccgcatcgtcgac
gggaaggaggccgtgaccttcctcgtccgcgtcaaggaggcgctggaggatccggcccgc
ctcgtgctggatctctga

DBGET integrated database retrieval system