KEGG   Methylobacterium populi: Mpop_1766Help
Entry
Mpop_1766         CDS       T00760                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
mpo  Methylobacterium populi
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mpop_1766
Enzymes [BR:mpo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Mpop_1766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1900302..1901171)
Genome map
AA seq 289 aa AA seqDB search
MPPDAPPPPSRLTELLPELGRRTLVMGILNVTPDSFSDGGRFEGVEAARAQAAALTEDGA
HILDIGGESTRPGHTPVPAAEEQARVLPVIEAVAPGLSVPISIDTYKASTAAAALKAGAT
IVNDVWGLQREPDIARVAADHGAPVIVMHNRETIDGSLDIVADMLRFFERSLDIARRAGI
ADGDIVLDPGIGFGKSWAQHLEALRRLPEIRALGFPLLVGVSRKSLLGRLHDRETAPRDR
LVGSLAAHVLAGSLGADIVRVHDVAPHVEALRVLDAVMRPDVASGSLHG
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgacgcccctcccccgccctcccgcctgaccgaactgctgcccgaactcggg
cggcggacgctggtgatgggcatcctcaacgtcacgccggactcgttctccgatggcggc
cggttcgagggcgtcgaggcggcgcgggcgcaggccgcagccctgaccgaggacggcgcc
cacatcctcgatatcggcggcgagtcgacccggcccggccacacgcccgtcccggccgcg
gaggagcaggcccgcgtcctgcccgtcatcgaggcggtcgcgcccggcctgtcggttccg
atctccatcgacacctacaaggcctcgacggcggcggccgccctgaaggccggcgccacc
atcgtgaacgacgtctggggcctgcagcgcgagccggacatcgcccgcgtcgccgccgat
cacggcgcaccggtcatcgtcatgcacaaccgcgagacgatcgacggctcgctcgacatc
gtcgccgacatgctgcgcttcttcgagcgttcgctggacatcgcccggcgcgccggcatc
gccgacggcgacatcgtgctcgatcccggcatcggcttcggcaagagctgggcgcagcat
ctcgaggcgctccgccggcttcccgaaattcgggcgctgggcttccccctcctcgtcggc
gtctcgcgcaagagcctgctcgggcgcctgcacgaccgcgagacggcgccgcgcgaccgg
ctcgtgggctcgctcgcggcgcatgtgctggccggctccctcggcgccgacatcgtgcgc
gtccacgacgtcgccccgcatgtcgaggcgctgcgggtgctcgatgcggtgatgcgcccg
gatgtcgcttccggatcgctccatggctga

DBGET integrated database retrieval system