KEGG   Methylobacterium populi: Mpop_1953Help
Entry
Mpop_1953         CDS       T00760                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mpo  Methylobacterium populi
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mpop_1953 (gmk)
Enzymes [BR:mpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mpop_1953 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2086530..2087201
Genome map
AA seq 223 aa AA seqDB search
MTQDATQGRPDIARRGLILILSSPSGAGKTTLTRAIAQDGGWGLDLSISVTTRARRPSEI
DGRHYRFIDREAFEDLRTRDDLLEWAEVHGNFYGTPRRPVEKTLAQGRDMIFDIDYQGTR
QVRQRLQDDVVTVFILPPSFSELRNRLERRAEDSPETIERRLANARNEMQRWSEYDYVIV
NDDLDESFRALQAILAAERLKRTRRTGLPGFVDGLLAEAERGA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggacgccacgcaaggcaggccggacatcgcccggcgcgggctgatcctgatc
ctgtcctcgccctcgggcgcgggcaagaccacgctgacgcgcgccatcgcccaggacggc
ggttggggcctcgacctgtcgatctcggtgacgacgcgggcgcgccgcccctcggagatc
gacgggcgccactaccgcttcatcgaccgcgaggcgttcgaggatctgcgcacccgcgac
gacctgctcgaatgggccgaggtccacggcaatttctacggcacgccccgccgcccggtg
gagaagaccctggcccagggccgggacatgatcttcgacatcgactaccaaggcacccgc
caagtcaggcagcggctgcaggacgacgtggtgacggtgttcatcctgccgccgagtttt
tcggaattgcgcaaccgcctggagcgccgggcggaggattcgcccgagaccatcgagcgg
cggctggccaatgcccgcaacgagatgcagcgctggagcgagtacgactacgtcatcgtc
aacgacgacctcgacgagtcttttcgcgcgcttcaggcgattctcgccgccgaacgcctc
aagcgcacgcgccgcaccggcctgccgggtttcgtggacgggcttctggccgaggccgaa
cggggcgcctga

DBGET integrated database retrieval system