KEGG   Methylobacterium populi: Mpop_2286Help
Entry
Mpop_2286         CDS       T00760                                 

Definition
oxidoreductase FAD/NAD(P)-binding domain-containing protein
Orthology
K00528  
ferredoxin--NADP+ reductase [EC:1.18.1.2]
Organism
mpo  Methylobacterium populi
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2445292..2446065
Genome map
AA seq 257 aa AA seqDB search
MSKYNEERVLSVHHWTDTLFSFRTTRDPSFRFRNGEFTMIGIEVEGRPLLRAYSVVSANY
EEELEFFSIKVPNGPLTSKLQHLKVGDPIMIGKKPTGTLVLDNLLPGRHLYLLGTGTGLA
PFLSIIKDPETYDRFEKVVLVHGCRQVQELAYGETITETLPKHEFLGEMIANQLIYYPTV
TREPFRNRGRITDLMVSGKLFEDIGLPAMSIENDRFMLCGSPEMIKDTREMLTGLGYEEG
NHGEAAHYVIEKAFVEK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtacaacgaggagcgcgttctctccgtccaccactggaccgacacgctcttc
tccttccgcacgacccgcgacccctcgttccgcttccgcaacggcgagttcacgatgatc
ggcatcgaggtcgagggccggccgctcctgcgcgcctactcggtcgtctcggccaattac
gaggaggagctggagttcttctcgatcaaggtgccgaacggcccgctcacctcgaagctg
cagcacctcaaggtcggcgacccgatcatgatcggcaagaagccgaccgggacgctggtg
ctcgacaacctcctgccgggccgtcacctctacctgctcgggaccggcacggggctcgcg
cccttcctgtcgatcatcaaggatccggagacctacgaccggttcgagaaggtcgtgctg
gtccacggctgccgccaggtgcaggagctggcctatggcgagaccatcaccgagacactg
ccgaagcacgagttcctgggcgagatgatcgccaaccagctcatctactacccgaccgtc
acccgcgagccgttccgcaaccgcggccggatcaccgacctgatggtctcgggcaagctg
ttcgaggatatcggccttcccgccatgtcgatcgagaacgaccgcttcatgctgtgcggc
tcgccggagatgatcaaggacacccgcgagatgctcaccggcctcggctacgaggagggc
aaccacggcgaggcggcccactacgtgatcgagaaggccttcgtcgagaagtga

DBGET integrated database retrieval system