KEGG   Methylobacterium populi: Mpop_2833Help
Entry
Mpop_2833         CDS       T00760                                 

Definition
bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
mpo  Methylobacterium populi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mpop_2833
Enzymes [BR:mpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Mpop_2833
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     Mpop_2833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3040855..3045807
Genome map
AA seq 1650 aa AA seqDB search
MNSDVTSSDVSASDVTALERLADLVGIADGFTDAFGQRVDTSLEVRRGMLEALGFSAGDD
DAIRRSLAAVETVRANVIPPLLAAEARRGLRVPVRMGVTSGAVAWRLVDEHDRSREGRAT
LTASEAGAGFDLPPLTPGYHQLTITVGDRRAMAWIVSAPQKCWRPRAYAEDGARDWGLAA
QLYGLRSPANLGIGTYADAGRAARDAALRGASFLGLSPAHALFPTDRAKISPYSPSSRLF
LETLYIEPGALPGFADSPAAALLEQYGPRIEALRDTSLVDHAGVWEVLSPILEAYWQGSG
ARAGTDAGFAAFRAEGGENLESHATFDALSEHFRKQGAHWLGDWPEEYRRAGTDAVRAFA
GEQAERIAYHVFLQYLADSQLKASSDLALKAGMRLGLYRDLAVGADRGGSEIWSHPERFA
NGVSIGAPPDLLAPKGQDWGLPAFDPLEMERDGLKAFRALVKANMRHAGAIRIDHAFQLA
RLFLIPLGRSAREGAYVAMPFEPMLAVLRLESHRAKCLVIAEDLGTAPEGFSDALMHSGI
LSYRILAFEREQGGAFKSPDAYPKDALTAITTHDLPTFVGWWRGVDTDTRQSLGLYDADR
AEAERTERVAERWRLSEALAAQQLLPSSEPPEHAPFEAAARYLARAPSILTAVQYEDVVG
ELSQANVPGSTEGYPNWRRKLDRNLEAIAAPGGPLAKLAAALSAEERGPRSGAARLASAP
PRATYRLQFHEGFTFADAEKIVPYLAKLGISHVYASPLQRARPGSTHGYDIVDHSQINPE
IGGEEGFRSFTDALHAHGLKLLLDIVPNHMGVGGADNPWWLSVLEWGGLSPAANAFDIDW
ERLGANGKLVIPFLGERYGEALEKGTLELKFDESAGAFSVWHYEHQFPICPLQYPTILNR
ALAALGEIGDDMSAEVLSITERLRAMGEETNFERRRAMPEAAEELKRQLAGAVRASPQIA
ASIYRALHLLNGNRDYPDSFGPLHRLLEQQSYRLAHWRIASSDINYRRFFDVNSLAGLRV
ELSDVFTKSHDLLFRLIGEGRIDGLRIDHIDGLADPLGYARALQAAVGPGFYIVVEKILE
PGEKLRDWPVAGTTGYDVLNQLDGILVDQALKPRIEKFYRWATDMDEPYGFQFRAAKAEI
LEISFASELEVMTGDLKQIADSDRRNRDFSTNAIRRALIEIVARFPVYRSYLPGDLDETE
IEAEDVRLIEGAVRKAKRWSALPDRSVHDFAADALLGRLDLGGAGHPDQQVVLRFRRRFQ
QLTGPVMAKSLEDTLFYRFVELLALNEVGGDPGEYGIDAEHFHALQAARARDWPNAMITT
ATHDTKRGEDARSRQLALSELPEEWARAWDTWRRASEPHIKQVEGEPAPDPNDQWMFLQA
ILGAWPLELLEGDDAGEIETFRKRLDAYAEKALRESKRRSSWVNVDEGYEGAVHALFAAL
VTPGSDCLNRLRPLVRRLAFLGMIAGLGRTVLKCTLPGIPDTYQGTEFWDFSFVDPDNRR
PVDYEERARALEAGGAPSELIGAWPDGRVKQATLARLLADRAARPAFYADADYRPLAAEG
ARADHVIAFTRSAATSGEDDLLVAVPRLVARLTPESGWSGEAFAGTVLTVPDGSRWVDVI
GGGEVAAEGDRLDLGRLFATLPYVVLRRAA
NT seq 4953 nt NT seq  +upstreamnt  +downstreamnt
gtgaactccgacgtgacctcttcagacgtgagtgcttccgacgtgactgccctcgaacgc
cttgccgacctcgtcggcatcgccgacggattcaccgatgccttcgggcagcgggtcgat
acctcgctcgaggtccgtcgcggtatgctcgaagccctcggcttttccgcgggcgacgac
gacgcgatccgacgcagcctcgccgccgtcgagacggtgcgcgccaacgtgatcccgccg
ctgctggcggccgaagcccggcgcggcctccgtgtgccggtgcggatgggcgtgacctcc
ggtgccgtggcgtggcggctcgtcgacgagcacgaccgctcccgcgagggccgtgccacc
ctgaccgcctccgaggccggtgctggtttcgacttgccgccgctgacgccgggctatcac
cagctcaccatcaccgtcggcgaccgccgggccatggcctggatcgtgtccgcgccgcag
aagtgctggcgcccgcgcgcctacgccgaggacggcgcccgcgactggggcctcgccgcc
cagctctacggcctgcgctcgcctgctaacctcggcatcggcacctacgccgatgccggc
cgcgccgcccgcgatgcggccctgcgcggcgcgtcgttcctcggcctgagcccggcccac
gccctgtttccgaccgaccgggccaagatctctccctactcgccgtcctcgcggctgttt
ctcgaaaccctctacatcgaacccggcgcattgcccggcttcgccgacagccccgccgcc
gcgcttttggagcagtacggccctcggatcgaggccctgcgtgacacctccctcgtcgat
catgccggtgtctgggaggtgctgtctccgatcctcgaagcctattggcagggatcgggg
gcgcgggccggcacggatgccggcttcgccgcgttccgcgcggaggggggtgagaacctc
gaatcgcacgccaccttcgacgcgctctcagagcatttccggaagcaaggcgcgcattgg
ctcggcgactggcccgaggagtaccgccgggccggcaccgatgccgtgcgcgcattcgcc
ggggaacaggccgagcgcatcgcctatcacgtcttcctgcagtacctcgccgacagccag
ctcaaggcctcgtccgatctggccctgaaggccggcatgcggcttgggctctaccgcgat
ctcgcggtcggcgccgaccggggcggctcggagatctggtctcacccggagcgcttcgcc
aatggcgtctccatcggcgcgccgccggacctgctcgcgccgaagggccaggattggggc
ctgccggccttcgatccgttggagatggagcgcgacggcctcaaggccttccgcgctctc
gtcaaagcgaacatgcgccatgccggcgcgatccgcatcgatcacgcattccagctcgcg
cgcctgttcctgatcccgctcggcaggtccgcccgcgagggcgcctatgtggcgatgccg
ttcgagccgatgctggcggtgctgcggctggagagccaccgcgccaaatgcctcgtcatc
gccgaggatctcggtaccgcgccggagggcttctccgacgcgctgatgcactccggcatc
ctcagctaccgcatcctcgccttcgagcgtgagcagggcggcgccttcaagtcccccgac
gcctatccgaaggacgcgctgaccgcgatcacgacgcatgacctgccgaccttcgtcggc
tggtggcgcggcgtcgataccgacacccggcagtccctgggcctctacgatgccgaccgg
gccgaagccgagcgcaccgagcgcgtcgccgagcgctggcgcctgtcggaggctctggcc
gcgcagcaattgctgccgagctccgagccgccggagcacgccccgttcgaggccgcggcc
cgctacctcgcccgcgcgccctccatcctcaccgcggtccagtacgaggacgtcgtcggc
gaactctcccaggccaacgttccgggctcgaccgagggctatccgaattggcggcgcaag
ctcgaccggaacctggaagccattgccgcaccgggcggcccgctggcaaaactcgccgcc
gccctgtcggcggaggagcgcgggccccgctcgggtgccgcgcgcctcgcctcggccccg
ccgcgggcaacctaccgcctgcagttccacgaggggttcaccttcgcggatgccgagaag
atcgtcccgtacctcgccaagctcgggatcagccacgtctacgcctcgccgctgcagcgg
gcgcggccgggatcgacccacggctacgacatcgtcgatcattcgcagatcaacccggag
atcggcggggaggagggctttcgcagcttcaccgacgcgcttcacgcgcacggactgaag
cttctgctcgacatcgtgcccaaccatatgggcgtcggcggcgccgataatccgtggtgg
ctctcggtgctcgaatggggcggcctgtcgcccgcggccaatgccttcgacatcgactgg
gagcggctcggcgccaacggcaagctcgtcattcccttcctcggcgagcgctacggcgag
gcgctggagaagggcacgctggaactgaagttcgacgagtccgccggcgccttcagcgtc
tggcactacgagcatcagtttccgatctgcccgctgcaatacccgacgattctgaaccgg
gcgctcgcggccttgggcgagatcggcgacgacatgtcggccgaagtgctctcgatcacc
gagcgcctgcgggcgatgggggaggagacgaatttcgagcgccgtcgggccatgcccgag
gccgccgaggagctgaagcgtcagcttgcgggcgccgttcgcgcctcgccgcagatcgcc
gcctcgatctaccgggcgctgcatctgctcaacggcaaccgcgactatcccgacagcttc
gggccgctgcaccggctgctggaacagcaatcctaccggctcgctcactggcgcattgcg
tcgagcgacatcaactaccgccgcttcttcgatgtgaattcgctcgccggcctgcgtgtc
gagctgtcggacgtgttcaccaagtcgcacgatctgctcttccgcctgatcggcgagggc
cggatcgacggtttgcgcatcgaccatatcgacggcctggccgatccgctcggatatgcc
cgcgcgctccaggcggcggtcggacccggcttctacatcgtggtcgagaagatcctggag
cccggcgagaagctgcgcgactggccggtggccgggaccaccggctacgacgttctgaac
cagctcgacggcatcctggtcgatcaggcgctgaagccgcgtatcgagaagttctatcgg
tgggccaccgatatggacgagccttacggcttccagttccgcgccgcgaaggcggagatc
ctggagatcagcttcgcctcggaactcgaggtgatgaccggcgacctcaagcagatcgct
gattccgacaggcgcaaccgcgacttctccaccaacgccatccgccgggcgctgatcgag
atcgtggcgcggtttcccgtctaccgctcctacctcccgggcgatctcgacgagaccgag
atcgaggccgaggacgtgcggctgatcgagggggccgtgcgcaaggccaagcgctggagc
gctctgccggatcgctcggtgcacgatttcgccgccgacgccctgctcggccgcctcgat
ctcggcggcgccggacatccggaccagcaagtggtcctgcgcttccgccgccgcttccag
cagctcaccggcccggtcatggccaagagcctggaagacaccctgttctaccgcttcgtc
gaactgctcgccctcaacgaggtcggcggcgatcccggcgagtatggcatcgacgccgag
cacttccatgcgcttcaggccgcgcgcgcccgcgactggccgaacgcgatgatcaccacg
gccactcacgacaccaagcgcggcgaggatgcccgctcgcgccagctcgccctgtccgag
ttgccggaggaatgggcgcgggcctgggatacgtggcgccgggcgtccgagccgcacatc
aagcaggtcgaaggtgaaccggcgccggacccgaatgaccagtggatgttcctccaggcc
atcctgggcgcgtggccgctggaacttctggaaggtgacgacgcgggcgagatcgagacg
ttccgtaagcgcctcgacgcctatgccgagaaggctttgcgcgagagcaagcgccggtcg
agctgggtcaatgtcgacgagggctacgagggcgcggtgcacgcgctcttcgcggcactc
gtcactcccggctccgattgcctgaaccggctgcgtcctctggtgcggcggctcgccttc
ctcggcatgatcgccgggctcggccgcaccgtcctcaaatgtaccctgccgggcattccc
gacacctaccagggcaccgagttctgggacttctccttcgtcgatcccgacaaccgccgg
ccggtcgattacgaggagagggctcgggccctggaggccggcggtgcgccctccgagctg
atcggcgcctggccggatggacgggtgaagcaggcgacgctggcgcgcctgctcgccgac
cgcgcggcgcgcccggccttctacgcggacgccgactaccggccgctcgccgcggaaggc
gcgcgcgccgaccacgtcatcgccttcactcgctcggcggcgacctccggcgaggacgac
ctcttggtggcggtgccccgcctcgtcgcacggctgacgcccgaatcgggttggtcgggc
gaggccttcgccggcacggtgctgaccgtgccggacggcagccgctgggtggacgtgatc
ggcggtggcgaggtggccgccgagggcgatcggctcgatctcggtcggctcttcgcaacg
ctgccctatgtggtgctgcggcgggctgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system