KEGG   Methylobacterium populi: Mpop_2836Help
Entry
Mpop_2836         CDS       T00760                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mpo  Methylobacterium populi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mpop_2836
Enzymes [BR:mpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mpop_2836
Exosome [BR:mpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mpop_2836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3052828..3055185
Genome map
AA seq 785 aa AA seqDB search
MTALDEKAAARNEGQAAANVPNRSGSTEAHRAPRPADSLGGDGGAPRVGRPTCQPRDGHL
HPDAVAAIMAADHGDAFGVLGPHQVAPGTWEVRAVLPEAKAARLLTGGQTVPFERVHPDG
FYVASVKSEGRPLYEIEVEAWDGSSTRRHDPYGFGPSLEQSEIEGLRQIGSNLVYRVLGA
HAGELDGIPGFRFAVWAPNARRVSVVGDFNDWDGRRHPMRLWLNGGVWELFVPGLKAGQN
YKFEIRGPDGALLPLKADPVAFRGQHPPQTASVLQGLNEPEWHDNAWMDSRGEKDPRHAA
MSVYEVHLGSWARVPGEGNRYLTYKELSDRLIPYVKELGFTHIELLPITEYPFDGSWGYQ
PVSLFAPTSRFGTPDDFVAFVNAAHEAGIGVLLDWVPGHFPLDAHGLGLFDGTHLYEHAD
PRQGFHQDWGTYIYNFGRTEVSAFLTANARFWLEHYHLDGLRVDAVASMLYLDYSRRAGE
WIPNQYGGNENLDAINFLRKTNEATYSHAPGTITVAEESTSWPGVSHPTYTGGLGFGFKW
NMGWMHDTLKYMSEDPIHRRYHHHNLTFGLLYAFSENFVLPLSHDEVVHGKGSLLGKMPG
DRWQKFANLRAYFGFMWGHPGKKLLFMGGEFGQEREWNHNQSLDWHLLDDPLHGGVKDLI
RDLNHVYTSTPALYTRDVEPGGFQWLVADDSDNSVIAWARKGKAEGEVAIVVSNFTPVPR
EGYRVGVPTAGYYREAINSDAERYGGSNVGNMGGVHSQSEQSHGQPHSLSLTLPPLSTLI
LIREG
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgacggctctggacgagaaggccgcggctcgaaacgaggggcaggcggccgccaacgtc
ccgaacaggtcaggctcgaccgaggcgcaccgcgcgccccggccggcggattcgctgggc
ggcgatggtggagcgccccgcgtgggccgccccacgtgccaaccccgcgacggccacctc
catcccgatgcggtcgccgccatcatggcggccgaccatggcgacgccttcggcgtgctg
ggaccgcatcaggtcgcgcccggcacctgggaggtccgcgcggtcctgcccgaggccaag
gcggcccgcctgctcaccggcgggcagaccgtcccgttcgagcgtgtccacccggatggg
ttctacgtcgcgagcgtgaagagcgaggggcgtcccctctacgagatcgaggtcgaggcc
tgggacggcagcagcacccgccgccacgatccctacgggttcggcccctccctcgaacag
agcgagatcgagggcctgcgccagatcggcagcaatctcgtctaccgcgtcctcggcgcc
catgccggcgaactcgacggcatccccggcttccgcttcgcggtctgggcgccgaacgcc
cgccgtgtcagcgtggtcggcgacttcaacgactgggacggccggcgccacccgatgcgg
ctgtggctgaacggcggcgtctgggaactcttcgtgccggggctcaaggccgggcagaac
tacaagttcgagatccgcggtcccgatggcgcgctgctgccgctcaaggccgatccggtc
gcgttccgtggccagcacccgccgcagacggcgtccgtacttcagggcctcaacgagccg
gaatggcacgataacgcctggatggacagccgcggcgagaaggatccccgccacgccgcc
atgtcggtctacgaggtgcatctcggctcgtgggctcgggtgccgggcgaaggcaaccgc
tatctcacctacaaggaattgtccgatcgcctgatcccctacgtcaaggaactcggcttc
acccatatcgagcttctgccgatcaccgagtacccgttcgacggctcctggggttatcag
ccggtctcgctgttcgccccgacgagccgtttcggcacgcccgacgacttcgtcgccttc
gtcaacgccgcccacgaggccggaatcggcgtgctgctcgattgggtgccggggcacttc
cccctcgatgcgcacgggctcggactgttcgacggcacgcatctctacgagcacgccgat
ccgcgccagggcttccaccaggattggggaacctacatctacaatttcggccgcacggaa
gtgtcggccttcctcaccgccaacgcccggttctggctggagcactatcatctcgacggc
ctgcgcgtggatgcggtggcctcgatgctctacctcgactattcgcgccgggcgggcgag
tggatcccgaaccagtacggcggcaacgagaatctcgacgccatcaacttcctgcgcaag
accaacgaggcgacctacagccacgcgccgggcaccatcacggtggcggaggaatcgacc
tcatggccgggcgtctcgcacccgacctataccggcggcctcggcttcggcttcaagtgg
aatatggggtggatgcacgacaccctgaaatacatgtcggaggatccgatccaccggcgc
taccaccaccacaacctgaccttcggcctgctctacgccttctcggaaaatttcgtcctg
ccgctctcccacgacgaagtcgtgcacgggaagggctcgctgctcggcaagatgccgggc
gaccgctggcagaaattcgcgaacttgcgcgcctatttcggcttcatgtggggccatccc
ggcaagaagctgctcttcatgggcggcgagttcggccaggagcgcgagtggaaccacaac
cagtccctcgactggcacctgctcgacgatccgctgcatggcggcgtcaaggatctgatc
cgcgacctcaaccacgtctacacctcgaccccggcgctctacacgcgggacgtggaaccg
ggcggcttccagtggctggtggcggacgattccgacaactcggtcatcgcctgggcgcgc
aagggcaaggcggagggcgaagtcgccatcgtcgtctcgaacttcacgccggtgccgcgg
gaaggctatcgcgtcggcgtgccgacggccggctattaccgcgaggcgatcaactccgac
gccgagcgctacggcggctcgaacgtcggcaatatgggcggcgttcacagccaatctgag
cagagtcacggccagccgcactctctgagcctgaccctgccgccgctatcgaccctgatc
ctgatccgcgaaggctga

DBGET integrated database retrieval system