KEGG   Methylobacterium populi: Mpop_2958Help
Entry
Mpop_2958         CDS       T00760                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mpo  Methylobacterium populi
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mpo02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mpo02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3188657..3189742
Genome map
AA seq 361 aa AA seqDB search
MSGEAENPRVRVLIVEDSLVVRILLTHIIARDPRLELAGAVESGEAALAAIETVRPDVIS
MDIRLPGIDGLETTRRIMASRPTPIVVIADSVEDSSLKISMNALRAGALSVVEKPVATTN
DGYEAVAGQICTQLRIMAAVPVIRRRPIGAEWNARRTGPAPEPLPTIEPDAAPSVLAVAA
STGGPPALAKVIGGLAADFPLPVLLVQHMGAAFMDGFANWLDGVVPLSVGVARDGQSMQA
GHVYVAPGDRHLELGANGTLRVSDAAPVGGQRPAATVLFRSVARQAGAQGIGVLLTGMGE
DGAQGLLDMRRAGAATVAEHESSAVVYGMPAAAVRLNAAARVLPVDQVAPHLVRLAQRKP
A
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggagaggctgagaatccgcgcgtgcgcgtgctgattgtcgaggattcgctcgtg
gtgcggatcctcctcacgcacatcatcgcccgcgacccgcgcctggaactcgccggcgcg
gtggagtccggcgaggcggcgctggccgcgatcgagaccgtgcggcccgatgtgatctcc
atggatatccgcttgcccggcatcgacgggctggagacgacgcgccggatcatggcgagc
cggccgacgccgatcgtggtgatcgccgactcggtcgaggattcctcgctcaagatctcg
atgaacgcgctcagggccggtgcgctctcggtcgtcgagaagccggtcgccaccaccaat
gacggctacgaggcggtggccgggcaaatctgcacgcaactgcgcatcatggccgccgtc
ccggtgatccgccgccggccgatcggcgcggagtggaacgcgcgcaggaccggaccggcg
ccggagccgctgccgacgatcgagcccgacgccgcgccgagcgtgctggcggtcgcggcc
tccaccggtggcccgccggccctggccaaggtgatcggcgggctcgcggcggatttcccg
ctccccgtgctgctcgtccagcatatgggcgcggccttcatggacgggttcgcgaactgg
ctcgacggtgtggtgccgctctccgtcggcgtggcgcgggacgggcagtcgatgcaggcc
ggccacgtctacgtcgcccccggcgaccggcatctcgaactcggcgcgaacggcacgctg
cgggtgagcgacgccgcgcccgtcggcggccagcgcccggcggcgacggtgctgttccgt
tccgtcgcccggcaggccggcgcgcagggcatcggcgtcctgctcacgggcatgggcgag
gacggcgcgcagggcctcctcgacatgcgcagggccggcgccgccacggtggcggagcat
gagagcagcgccgtcgtctacggcatgcccgcggccgcggtgcggctcaacgcggccgcc
cgcgtgctgcccgtcgatcaggtagcgccccatctcgtgcgtctcgcgcagaggaagccg
gcatga

DBGET integrated database retrieval system