KEGG   Methylobacterium populi: Mpop_2987Help
Entry
Mpop_2987         CDS       T00760                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mpo  Methylobacterium populi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpop_2987
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mpop_2987
Enzymes [BR:mpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Mpop_2987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3219404..3220594
Genome map
AA seq 396 aa AA seqDB search
MHRNRLHIRNRRVARNDCRMTVVRPPALEDFRRVVVKVGSALLVDRARGRLRHAWLAALA
EDIADLHGRGVDVVVVSSGAIALGRTVLGLPPGTLRLEESQASAAVGQIALARYWTEALG
HHDIVAGQVLVTPKDTEERRRYLNARATVQKLLEVRAVPVVNENDTVATAEIRYGDNDRL
AARVATMIGADVLVLFSDIDGLYTAPPHSDPQARHLPVVERVTPEIEAMAGGPASELSRG
GMRTKVEAAKIAASGGTHMVIADGRGKNPLRVVREGGRCTWFLSGSTPTAARKTWIAGSL
DASGTLIVDAGAARALEGGASLLPVGVTAIEGSFAKGDTVLIRGPEGRILGRGLVAYDSA
DAAAIIGRSSREIAAASVQAGRTEMIHRDDLAMIGT
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggaaccggcttcacatccgaaaccgccgcgttgcccgtaacgactgtcgcatg
accgtggtccgccctcccgctctcgaagatttccgccgcgtcgtcgtcaaggtgggctcg
gccctcctggtcgatcgcgctcggggccggctgcgccatgcctggctcgccgcgctggcc
gaggacatcgccgacctgcacggccggggtgtcgatgtggtggtcgtctcctccggtgcc
atcgccctcgggcgcacggtgctgggcctgccgcccgggacgctgcgcctggaagagagc
caagcctcggctgcggtcggccagatcgcgctcgcccggtactggaccgaggcgctcggg
caccacgacatcgtcgccggacaggtgttggtgacgccgaaggacaccgaggagcgccgc
cgctacctcaacgcccgcgcgaccgtgcagaagctcctcgaagtgcgcgcggtgccggtc
gtgaacgagaacgataccgtcgcgaccgccgagatccgctacggcgacaacgaccggctg
gcggcgcgcgtcgcgaccatgatcggcgccgacgtgctggtgctgttctccgacatcgat
ggcctctacaccgcaccaccccacagcgacccgcaggcccgccaccttccggtggtggag
cgggtgacgccggagatcgaggcgatggccggcggccccgcctcggagctgtcccgcggc
ggcatgcgcaccaaggtcgaggcggccaagatcgcggccagcggcggcacgcacatggtc
atcgccgacggccgcgggaagaatcccctgcgggtcgttcgcgagggcggccgctgcacg
tggttcctgtcgggctcgacgccaaccgccgcgcgcaagacctggatcgcgggatcgctg
gacgcgtccggcaccctcatcgtcgatgccggcgccgcccgcgcactcgagggcggcgcg
agcctgctgccggtgggcgtcaccgccatcgagggcagcttcgccaagggcgacaccgtg
ctcatccgagggcccgagggacgcatcctgggccgcggcctcgtcgcctacgacagcgcg
gatgccgccgccatcatcggccgctccagccgcgagatcgccgccgcctcggtccaggcc
ggacgcacggagatgatccaccgcgacgacctcgcgatgatcggaacctga

DBGET integrated database retrieval system