KEGG   Methylobacterium populi: Mpop_3146Help
Entry
Mpop_3146         CDS       T00760                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mpo  Methylobacterium populi
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mpop_3146
Enzymes [BR:mpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Mpop_3146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3381947..3383257)
Genome map
AA seq 436 aa AA seqDB search
MRLPQEIIRDKRDGRALSEADIAGFIDGLTREQVTEGQAAAFAMAVFFRGLALDERVALT
RAMTQSGTVLEWDLPGPVLDKHSTGGVGDTVSLPLAAMVAACGGYVPMISGRGLGHTGGT
LDKLASIPGYDVTPGLDRFRAVVVQTGCAIIGQTADLAPADRRLYAIRDVTGTVESLDLI
TASILSKKLAAGLQGLVMDVKTGSGAFMAELEAARALAESIVTVANAAGLRTRAVITDMD
APLASCAGNAVEVAYAVDYLTGRAREPRFHAVTLALAAEMLVIGGLAADLAEAQSRLTAA
LDSGRACEAFSRMVAALGGPGDFVEAAERHLPRAAVIRPVTAEVEGIVERIDTRAVGLAV
IGLGGGRTRPQDAIDPSVGFTGLARPGDRLEPGASLGTVHAANETAAETAARALRAAYRL
GEARQEPREAVLERLG
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagactcccccaggagatcatccgcgacaagcgcgatgggcgcgccctgtccgaggcg
gacatcgccggcttcatcgacggcctgacgcgggagcaggtcaccgaggggcaagcggcc
gccttcgccatggcggtgttcttccgtggtctcgccctcgacgagcgcgtggcgctgacc
cgcgccatgacgcaatcgggcacggtcctcgaatgggacctgcccggtcccgtcctcgac
aagcattccaccggcggcgtcggcgacaccgtgagcctgccgctcgcggcgatggtggcg
gcctgcggcggctacgtgccgatgatctcggggcgcggcctcggccataccggcggcacc
ctggacaagctcgccagcatccccggctacgacgtgacgccggggctcgaccgcttccgc
gcggtggttgtgcagaccggctgcgccatcatcggccagaccgccgacctcgccccggcc
gaccggcgcctctacgccatccgcgacgtgaccggcaccgtcgaatcgctcgatctcatc
accgcgtcgatcctttcgaagaagctcgcggcggggctccagggcctcgtcatggacgtg
aagaccggctccggcgccttcatggcggagcttgaggcggcgcgggctctggccgagagc
atcgtcacggtagccaacgccgcggggctgcgcacccgcgccgtcatcaccgacatggat
gcgccgctcgcctcctgcgccggcaacgcggtcgaggtggcctacgccgtcgattacctc
accggccgcgcccgcgagccgcgcttccacgcggtgacgctggcgctcgccgccgagatg
ctggtgatcggcggtctcgccgcggatctcgcggaggcgcagtcgcgcctgacggcggcg
ctcgattcggggcgggcctgcgaggcgttttcgcggatggtcgcggcgctcggcggcccc
ggcgatttcgtggaggcggcggagcggcatctgccgcgggcggccgtgatccggccggtc
accgccgaggtggaaggcatcgtggagcggatcgatacccgtgccgtcggcctcgccgtg
atcggcctcggcggtgggcgcacccggccccaggacgcgatcgatccgagcgtgggcttt
accggtctcgcccgcccgggtgaccggctggaaccgggcgcttcgcttggcaccgtccac
gctgcgaacgagaccgcggccgagacggcggctcgcgccctgcgggcggcctaccgtctc
ggcgaagcgcggcaggagccgcgcgaggccgtgctggagcggttgggctga

DBGET integrated database retrieval system