KEGG   Methylobacterium populi: Mpop_3229Help
Entry
Mpop_3229         CDS       T00760                                 

Definition
(GenBank) Exodeoxyribonuclease V
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mpo  Methylobacterium populi
Pathway
mpo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mpop_3229
Enzymes [BR:mpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Mpop_3229
DNA repair and recombination proteins [BR:mpo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Mpop_3229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 HHH_4 Viral_helicase1 AAA_11 PIF1 HHH_5 Herpes_Helicase PhoH AAA Zeta_toxin Helicase_RecD SR-25
Motif
Other DBs
NCBI-ProteinID: ACB81380
JGI: Mpop3229
UniProt: B1ZHR2
Position
complement(3454960..3456873)
Genome map
AA seq 637 aa AA seqDB search
MLTPVGEALVRHLAQDAAFAGIGPVTAGRLWNRFGDDLPRVLSDGDADALASVVGEERAS
SLVIAWRERQALGDIVVWLGENGFDIRLAGRITALWGAEAARRLRARPYDLMAVAPWAAV
DAAACRIGVPRDAPERLVAAVESVLYERFEEHHTWIASGELLDEVGRRLDCDGDRAGEAV
HLALLEGAAFEAEGGYQAAGAHMMEGYVAGRLRAMTASAPVGDLVARPVTGPEVERWLRD
AEASAGPVLDPEQREAVRLGLQAALGLMVGGAGVGKTTALRAICGAAGSHGHVVHLVALA
GRAAVRMGEATAHPASTIAAFLGRIESGEVVLGPQTLVVVDEASMVDLPTFYRLLRRMPE
GSRLLLVGDDAQLPPIGFGLVFHELVDVPDIPKVTLVRVHRQAAATGIPLVAAAVRSGTL
PVMDKELTGPGFGVAFLDGSSDGQATLDDVVDAVATCGGWRDDLRILCPTKGGPVGTEAV
NACFHDLLTRGHDRMPGRGFAAGEPVMFLRNDYRLDLRNGSLGTVTGFDGQVLEVDFDGR
RHELSGRNLDDTALAYAVTVHKAQGSAFRRVVMPVTPTRLLDRSLVYTAITRAREQAVLV
GDRRAFARAVQAATSANRRFTGLKAAMRKQAVDEGAA
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgcccgttggggaagccctcgttcgccatctcgcccaggacgccgctttcgct
ggcatcggtccggtcaccgccggccgcctctggaacaggttcggcgacgacctcccgcgc
gtgctgtccgatggggatgccgacgccttggcgagcgtcgtcggcgaggagcgcgcgtcc
agcctcgtcatcgcctggcgcgagcggcaggccctcggcgacatcgtcgtatggctcgga
gagaacggtttcgacatacggctggccgggcgcatcaccgccctgtggggtgccgaagcg
gcccgacgcctgcgcgcccggccgtatgacctcatggccgtggctccctgggccgcggtt
gatgccgccgcgtgccggattggcgtccctcgggatgcgccggagcgcctggtcgcggcc
gtcgagagcgtcctctacgaacgcttcgaggagcatcacacctggatcgcgagcggcgag
ctgctggatgaggtcgggcggaggctcgattgcgacggcgacagagctggcgaggcggtt
cacctggccctcctggagggggccgccttcgaggcagagggcgggtaccaggctgccggt
gcccacatgatggaggggtatgtcgccggacgcctccgcgcgatgacagcttcggcgccc
gtgggcgacctcgtcgcgcggccggtcaccggtcccgaggtcgagagatggctccgggac
gccgaggcttcagcgggccccgtcctcgatcccgaacagcgagaggccgtcaggctgggc
ctccaggccgccctcggcctcatggtgggcggggcaggggttggcaagaccacggcgttg
cgggcgatctgcggcgcggcagggtctcacgggcacgtggtccacctcgtcgccctggcc
ggccgtgccgcggtgcggatgggggaggcgaccgcacacccggcctcgaccatcgcggcc
ttcctcgggcgcatcgaatcgggcgaggtcgtgctgggtccccagaccctggtcgtcgtg
gacgaggcgtcgatggtcgacctgcccaccttctacaggcttctccggcgcatgcccgag
ggttcccgcctgctcttggtcggcgacgatgcccagttgccgcccatcggtttcgggctc
gttttccacgaactggtcgatgtgccggacatccctaaggtcaccctggtccgcgtgcat
cggcaagcggccgccaccggcatcccgctcgtcgccgcggccgtgcggtccgggacgctg
ccggtgatggacaaggagctgactggacccggcttcggcgtcgccttcctcgacggctcc
tccgacggccaggcgaccctcgacgatgttgtggatgccgtcgcgacctgcggggggtgg
cgggacgacctgcgcatcctctgcccgaccaagggcggccccgtcgggaccgaagcggtc
aatgcgtgtttccacgacctgcttacccgggggcacgaccgcatgccgggacgtggcttc
gccgccggtgagcccgtcatgttcctgcgcaacgattaccgcctcgatctccgcaacggg
tccctcgggaccgtgacgggtttcgacggtcaggtcctggaggtcgatttcgatggccgc
cgacacgagctctcgggccggaacctcgatgacacggcgcttgcctatgccgttaccgtc
cacaaggcgcagggatcggccttccgccgcgtcgtgatgcctgtgacaccgacgcgcctg
ctggaccgctcgctggtctatacggcaataacccgggctcgggagcaggccgtgctggtc
ggcgaccggcgggcgttcgcgagggcggttcaggcggcaacgagtgccaaccgcaggttc
acgggcctgaaggcggcgatgcggaagcaggcggtggacgagggggctgcgtga

DBGET integrated database retrieval system