KEGG   Methylobacterium populi: Mpop_3261Help
Entry
Mpop_3261         CDS       T00760                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mpo  Methylobacterium populi
Brite
Enzymes [BR:mpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mpop_3261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(3485975..3487057)
Genome map
AA seq 360 aa AA seqDB search
MAEMRAMMPGQVQQQSDPGLERARRPAEAAWEALGRYGLPPSPRNYELLHSFYSGANPTL
RERLAPCLAPGGTLTEELAGTLYESCIADTAPGAIVLDGASRLADAAGRLAERVAGSRRA
LAGYADALTHWSGRLNARPTEDELMTALVALIGETEQAQARNRLLEEQLSVSAGHIDRLH
RDLVEAQRAAVTDTLTGLANRKAFDQFLRDAITRTRADSGSTFCLIMLDIDHFKGLNDRH
GHRFGDQVLRLLARLLSEKTTDRDLAARYGGEEFAIVLGEAGIGAGVALAQLVCDRLRGQ
RLVKRGSGEVVAQVTISAGVAQYRPGEAARDVIERADRALYEAKRTGRDRVCPRPQAAGA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatgcgggcgatgatgccgggacaggtgcagcagcagtcggatccgggcctc
gaacgcgcccggagacctgcggaagccgcctgggaggcactcggccggtacgggcttccc
ccctcgccccggaactacgaactgctgcacagcttctacagcggtgccaatccgacgctg
cgcgaacgcctcgcaccctgcctggctcccggcgggacgctgacggaggagctcgcgggc
acgctctacgagtcctgcatcgccgacaccgcgcccggggccatcgtgctcgatggcgcg
agccgactggccgacgcggcgggccgcttggcggaacgggtcgcgggcagccggagggcc
ctggccggctacgccgacgccctgacccactggtccggccgcctgaatgcccgcccgacc
gaggacgagttgatgacggcgctcgtcgccctgatcggcgagacggagcaggcgcaggcc
cgcaaccgcctgctggaggagcagctctcggtctccgccggccatatcgacaggctgcac
cgcgatctcgtcgaggcgcagcgcgcggcggtgaccgacacgctgacggggctcgccaac
cgcaaggccttcgatcagttcctgcgcgacgccatcacccggacacgggccgattccggc
agcaccttctgcctgatcatgctcgacatcgatcatttcaaggggctcaacgaccggcac
ggccaccgcttcggcgatcaggtgttgcggctcctcgcgcgcctgctgtcggagaagacc
accgaccgcgatctcgccgcgcgctacggcggcgaggagttcgcgatcgtgctcggcgag
gccggcatcggcgccggcgtggcgctcgcccagctggtctgcgaccggctgcggggccag
cgcctggtcaagcgcggctccggtgaggtggtggcacaggtcacgatctcggccggcgtc
gcgcagtaccggccgggcgaggccgcccgcgacgtgatcgagcgggccgaccgcgcgctc
tacgaagccaagcggacgggccgcgaccgcgtctgcccccggccgcaggccgccggtgcc
tga

DBGET integrated database retrieval system