KEGG   Methylobacterium populi: Mpop_3261Help
Entry
Mpop_3261         CDS       T00760                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mpo  Methylobacterium populi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3485975..3487057)
Genome map
AA seq 360 aa AA seqDB search
MAEMRAMMPGQVQQQSDPGLERARRPAEAAWEALGRYGLPPSPRNYELLHSFYSGANPTL
RERLAPCLAPGGTLTEELAGTLYESCIADTAPGAIVLDGASRLADAAGRLAERVAGSRRA
LAGYADALTHWSGRLNARPTEDELMTALVALIGETEQAQARNRLLEEQLSVSAGHIDRLH
RDLVEAQRAAVTDTLTGLANRKAFDQFLRDAITRTRADSGSTFCLIMLDIDHFKGLNDRH
GHRFGDQVLRLLARLLSEKTTDRDLAARYGGEEFAIVLGEAGIGAGVALAQLVCDRLRGQ
RLVKRGSGEVVAQVTISAGVAQYRPGEAARDVIERADRALYEAKRTGRDRVCPRPQAAGA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggccgagatgcgggcgatgatgccgggacaggtgcagcagcagtcggatccgggcctc
gaacgcgcccggagacctgcggaagccgcctgggaggcactcggccggtacgggcttccc
ccctcgccccggaactacgaactgctgcacagcttctacagcggtgccaatccgacgctg
cgcgaacgcctcgcaccctgcctggctcccggcgggacgctgacggaggagctcgcgggc
acgctctacgagtcctgcatcgccgacaccgcgcccggggccatcgtgctcgatggcgcg
agccgactggccgacgcggcgggccgcttggcggaacgggtcgcgggcagccggagggcc
ctggccggctacgccgacgccctgacccactggtccggccgcctgaatgcccgcccgacc
gaggacgagttgatgacggcgctcgtcgccctgatcggcgagacggagcaggcgcaggcc
cgcaaccgcctgctggaggagcagctctcggtctccgccggccatatcgacaggctgcac
cgcgatctcgtcgaggcgcagcgcgcggcggtgaccgacacgctgacggggctcgccaac
cgcaaggccttcgatcagttcctgcgcgacgccatcacccggacacgggccgattccggc
agcaccttctgcctgatcatgctcgacatcgatcatttcaaggggctcaacgaccggcac
ggccaccgcttcggcgatcaggtgttgcggctcctcgcgcgcctgctgtcggagaagacc
accgaccgcgatctcgccgcgcgctacggcggcgaggagttcgcgatcgtgctcggcgag
gccggcatcggcgccggcgtggcgctcgcccagctggtctgcgaccggctgcggggccag
cgcctggtcaagcgcggctccggtgaggtggtggcacaggtcacgatctcggccggcgtc
gcgcagtaccggccgggcgaggccgcccgcgacgtgatcgagcgggccgaccgcgcgctc
tacgaagccaagcggacgggccgcgaccgcgtctgcccccggccgcaggccgccggtgcc
tga

DBGET integrated database retrieval system