KEGG   Methylobacterium populi: Mpop_3589Help
Entry
Mpop_3589         CDS       T00760                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mpo  Methylobacterium populi
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mpo00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mpo00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3831370..3832425
Genome map
AA seq 351 aa AA seqDB search
MISASSTSASMTSASTPRAVILGCSGTALTPEEAAFFRDLRPWGFILFKRNIGTPDAVRA
LTAALRETVGRADAPILIDQEGGRVQRMGPPHWPKYPAGGRFDALGDEAAATARLGARLM
AHDLSEVGINVDCAPMLDVPAAGSDNIIGDRAYGDTPGRVIELGRAVAEGLMAGGVLPVI
KHIPGHGRATCDSHLDLPVVEADRVSLGESDFRPFRALADMPLAMSAHVVFNALDPERPA
TLSERVMREVVRGEIGFDGLLMTDDLSMHALHGPFRDRAEAAYRAGIDVVLHCNGRMDEM
RAVAEATPDLTGEGARRAEAALARLAPPEAFDVTEARARFEAAFSNTLPSA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatctccgccagttcgacctctgccagcatgacctccgccagcacgccccgcgccgtc
atcctcggctgctccggcacggcgttgacgcccgaggaggctgccttcttccgcgacctg
cggccctggggcttcatcctgttcaagcgcaacatcggcacgcccgacgccgtgcgcgcg
ctcaccgccgccctgcgcgagaccgtcggccgggcggacgcgccgatcctgatcgaccag
gaaggcgggcgggtgcagcgcatgggcccgccgcactggccgaaatatccggcgggcggg
cgcttcgacgccctcggggacgaggccgcggcgacggcccggctcggtgcccggctgatg
gcccacgatctctccgaggtcggcatcaatgtcgattgcgcgccgatgctcgacgtgccg
gcggcaggctccgacaacatcatcggcgaccgggcctacggcgacacgccggggcgggtg
atcgaactcggccgcgccgtggccgaggggctgatggcgggcggggtgctccccgtcatc
aagcacattcccggacacggtcgggcgacctgcgacagccatctcgacctgcccgtggtc
gaggccgaccgggtgagcctgggagagagcgacttccgcccgttccgggcgctcgccgac
atgccgctcgccatgagtgcgcatgtggtcttcaacgccctcgatcccgagcgccccgcc
accctgtcggagcgcgtgatgcgcgaggtcgtgcgcggcgagatcggtttcgacggcctg
ttgatgaccgacgatctgtcgatgcacgcactccacggcccattccgggatcgtgccgag
gccgcctaccgcgccggcatcgacgtcgtgctccattgcaacggacgcatggacgagatg
cgggcggtggccgaggcgacgcccgacctgacgggggagggcgcccggcgcgccgaggcc
gcgctcgcccgcctcgcgcccccggaggctttcgatgtgaccgaggcccgcgcccgcttc
gaggccgccttctcgaacaccttgccgagcgcctaa

DBGET integrated database retrieval system