KEGG   Methylobacterium populi: Mpop_3589Help
Entry
Mpop_3589         CDS       T00760                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mpo  Methylobacterium populi
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mpop_3589
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Mpop_3589
Enzymes [BR:mpo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Mpop_3589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3831370..3832425
Genome map
AA seq 351 aa AA seqDB search
MISASSTSASMTSASTPRAVILGCSGTALTPEEAAFFRDLRPWGFILFKRNIGTPDAVRA
LTAALRETVGRADAPILIDQEGGRVQRMGPPHWPKYPAGGRFDALGDEAAATARLGARLM
AHDLSEVGINVDCAPMLDVPAAGSDNIIGDRAYGDTPGRVIELGRAVAEGLMAGGVLPVI
KHIPGHGRATCDSHLDLPVVEADRVSLGESDFRPFRALADMPLAMSAHVVFNALDPERPA
TLSERVMREVVRGEIGFDGLLMTDDLSMHALHGPFRDRAEAAYRAGIDVVLHCNGRMDEM
RAVAEATPDLTGEGARRAEAALARLAPPEAFDVTEARARFEAAFSNTLPSA
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgatctccgccagttcgacctctgccagcatgacctccgccagcacgccccgcgccgtc
atcctcggctgctccggcacggcgttgacgcccgaggaggctgccttcttccgcgacctg
cggccctggggcttcatcctgttcaagcgcaacatcggcacgcccgacgccgtgcgcgcg
ctcaccgccgccctgcgcgagaccgtcggccgggcggacgcgccgatcctgatcgaccag
gaaggcgggcgggtgcagcgcatgggcccgccgcactggccgaaatatccggcgggcggg
cgcttcgacgccctcggggacgaggccgcggcgacggcccggctcggtgcccggctgatg
gcccacgatctctccgaggtcggcatcaatgtcgattgcgcgccgatgctcgacgtgccg
gcggcaggctccgacaacatcatcggcgaccgggcctacggcgacacgccggggcgggtg
atcgaactcggccgcgccgtggccgaggggctgatggcgggcggggtgctccccgtcatc
aagcacattcccggacacggtcgggcgacctgcgacagccatctcgacctgcccgtggtc
gaggccgaccgggtgagcctgggagagagcgacttccgcccgttccgggcgctcgccgac
atgccgctcgccatgagtgcgcatgtggtcttcaacgccctcgatcccgagcgccccgcc
accctgtcggagcgcgtgatgcgcgaggtcgtgcgcggcgagatcggtttcgacggcctg
ttgatgaccgacgatctgtcgatgcacgcactccacggcccattccgggatcgtgccgag
gccgcctaccgcgccggcatcgacgtcgtgctccattgcaacggacgcatggacgagatg
cgggcggtggccgaggcgacgcccgacctgacgggggagggcgcccggcgcgccgaggcc
gcgctcgcccgcctcgcgcccccggaggctttcgatgtgaccgaggcccgcgcccgcttc
gaggccgccttctcgaacaccttgccgagcgcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system