KEGG   Methylobacterium populi: Mpop_3699Help
Entry
Mpop_3699         CDS       T00760                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mpo  Methylobacterium populi
Brite
Enzymes [BR:mpo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mpop_3699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3946945..3947931
Genome map
AA seq 328 aa AA seqDB search
MRRPVAAAAALILAAAPFGLPSASPSAWRWSLPDRLAVPVVPADNPMSAVKVALGRRLFY
DADLSIDGTMACATCHEQKRGFADGTRTRPGVHGDQGLRNVPGLANVAWLPSLTWGDPRI
TSLEAQAYVPLFGTQPVEMGMAGQEPELVRRLHGDACYRQLFRAAFPERGGAIDIGTVTK
ALASFQRSLVSYDAPVDRGETSPAGAALFRNDCAGCHSGSNFTDGRFHRITSRLRMDRGL
ADITGRTEDAGLFRTPSLRNVAVTAPYLHDGRAATLREAIAAHGYVYEPAQSDALLAYLH
ALTDLGFLSRSELSYPDSPCAFLDGDDR
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaggcccgtcgctgcagcggccgctctgatcctggccgccgcgccgttcggcctg
ccatcggcgtcgccctcggcttggcgctggtcgctgccggaccgtttggccgttccggtt
gttccagccgacaacccgatgagcgccgttaaggtcgcactcggccggcgcctgttctac
gacgccgacctatcgatcgacggcacgatggcctgtgctacctgccacgagcagaagcgc
ggcttcgccgatggaacccgcacacgcccgggagtgcatggcgaccaagggctccgcaac
gtaccaggcttggccaacgtcgcatggctgccgagtctgacctggggcgatccgcggatc
accagcctggaggctcaggcttacgttccgctcttcggcacgcagccagtcgaaatggga
atggcgggacaggagcccgagctcgtacgccgcctccacggcgacgcatgctatcggcag
ctgtttcgcgccgcatttcccgaacggggtggggcaatcgacatcggcactgtcaccaag
gcgctggccagtttccagcgcagtttggtttcctacgatgcccctgtcgatcgtggcgag
acttcgccggccggtgccgccctcttcaggaacgattgcgccggctgccattccggcagc
aatttcaccgacggacgcttccaccgcatcaccagccggctccgcatggatcgcggcctt
gccgatatcaccgggcgcacggaagatgctggcctgttccgtacgccgagccttcggaac
gtagcggtaaccgctccctacctccatgatggcagggccgccacgttgagggaagccatc
gcagctcatggatacgtctacgaaccggcgcagagcgatgcgcttcttgcttacttgcat
gccctcacggatctcggcttcctgagccggagcgagctttcttatcccgacagcccctgc
gcgttccttgatggcgatgatcgttga

DBGET integrated database retrieval system