KEGG   Methylobacterium populi: Mpop_4277Help
Entry
Mpop_4277         CDS       T00760                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mpo  Methylobacterium populi
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpop_4277
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpop_4277
   00650 Butanoate metabolism
    Mpop_4277
  Energy metabolism
   00190 Oxidative phosphorylation
    Mpop_4277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4563259..4563678
Genome map
AA seq 139 aa AA seqDB search
MSQVDNRQNTALSMRTPRARVKGLGASGHGASHFWLQRLTGASNALLMLAFVVIIALMAG
RTYPQAVALVSHPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAV
AVAAACLYAIIRVSLGGLA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggtcgataaccgccagaacaccgcgctctcgatgcgcacgccccgcgcccgg
gtgaaggggctcggcgcctcgggtcacggggccagtcatttctggctgcagcgcctgacc
ggcgcctcgaacgccctcctgatgctcgccttcgtcgtcatcatcgccctgatggccggg
cggacctacccgcaggcggtcgcgctggtgtcgcacccgctcgttgcgatcatcctgatc
ctggccgtggtgtcggtgacgatccacatgcgtctggggatgcagacggtgatcgaggac
tacgtccacagccacggcctcaagttcgcggcgctcatcgccaacaccttctacgcggtc
gcggtggccgccgcctgcctctacgcgatcatccgcgtgagcctgggcggcctcgcctga

DBGET integrated database retrieval system