KEGG   Methylobacterium populi: Mpop_4277Help
Entry
Mpop_4277         CDS       T00760                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mpo  Methylobacterium populi
Pathway
mpo00020  Citrate cycle (TCA cycle)
mpo00190  Oxidative phosphorylation
mpo00650  Butanoate metabolism
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01200  Carbon metabolism
Module
mpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mpo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mpop_4277
   00650 Butanoate metabolism
    Mpop_4277
  Energy metabolism
   00190 Oxidative phosphorylation
    Mpop_4277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ACB82383
JGI: Mpop4277
UniProt: B1ZDZ0
Position
4563259..4563678
Genome map
AA seq 139 aa AA seqDB search
MSQVDNRQNTALSMRTPRARVKGLGASGHGASHFWLQRLTGASNALLMLAFVVIIALMAG
RTYPQAVALVSHPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAV
AVAAACLYAIIRVSLGGLA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggtcgataaccgccagaacaccgcgctctcgatgcgcacgccccgcgcccgg
gtgaaggggctcggcgcctcgggtcacggggccagtcatttctggctgcagcgcctgacc
ggcgcctcgaacgccctcctgatgctcgccttcgtcgtcatcatcgccctgatggccggg
cggacctacccgcaggcggtcgcgctggtgtcgcacccgctcgttgcgatcatcctgatc
ctggccgtggtgtcggtgacgatccacatgcgtctggggatgcagacggtgatcgaggac
tacgtccacagccacggcctcaagttcgcggcgctcatcgccaacaccttctacgcggtc
gcggtggccgccgcctgcctctacgcgatcatccgcgtgagcctgggcggcctcgcctga

DBGET integrated database retrieval system