KEGG   Methylobacterium populi: Mpop_4397Help
Entry
Mpop_4397         CDS       T00760                                 

Definition
agmatinase
Orthology
K18459  
guanidinopropionase [EC:3.5.3.17]
Organism
mpo  Methylobacterium populi
Brite
Enzymes [BR:mpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.17  guanidinopropionase
     Mpop_4397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4692429..4693430)
Genome map
AA seq 333 aa AA seqDB search
MAQDSEAAGARAERLARFRPASGMVTPRFSGLSSFMRLPVLDPDAAPGAVEIGLIGIPFD
GATTNRPGARLGPRALREASTGTRALNHATGVAPYALAACADLGDVPVNPVDAAETARRI
EAFYRPLAEAGIVPLTVGGDHFVTYPVLRALGAARPLGLIHIDAHSDTDDAQYDGSRLTH
GTPFRRAIEAGVLDPRRCIQIGIRGSMDAADERDWALAQGLRIIAMEEVCARGLPEVAAE
ARAVVGEGPTYLSFDIDALDPAFAPGTGTPEIGGFTTREALHLLRALRGLDLVGADVVEV
APSLDPAGLTALAGAGIAFEILCLLAERVAARA
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggacagcgaggccgcgggcgcgcgggcggaacggctggcgcggttccggccc
gcctcggggatggtgacgccgcgcttctccggtctttcgagcttcatgcggctgccggtg
ctcgatcccgacgcggccccgggcgcggtcgagatcggcctgatcggcattcccttcgac
ggcgccaccaccaaccggcccggcgcccggctcgggccgcgggctttgcgcgaggcttcc
accggcacgcgggcgctcaaccacgccacgggggtggcgccctacgcgctcgcggcctgc
gccgatctcggcgacgtgccggtcaacccggtggacgccgccgagaccgcccggcggatc
gaggcgttctaccggccgctcgcggaggcgggaatcgtgccgctcacggtcggcggcgac
catttcgtcacctacccggtgctgcgggccctcggcgccgcccggccgctcgggctgatc
catatcgatgcccacagcgacaccgacgatgcgcagtacgacggatcgcggctcacccac
ggcacgccgttccggcgcgccatcgaggcgggggtgctcgacccgcggcgctgcatccag
atcggcatccgcggcagcatggacgcggccgacgagcgcgactgggcgctggcgcagggc
ctgcggatcatcgcgatggaggaggtctgcgcccgcggcctgccggaggtggccgcggag
gcccgcgccgtcgtgggcgagggtccgacctatctcagcttcgacatcgacgccctcgat
cccgccttcgcccccggcaccggcaccccggagatcggcggcttcactacgcgggaggca
ctgcacctgctgcgggccctgcgcgggctcgatctcgtcggggcggacgtggtcgaggtc
gccccctccctcgatcccgccggcctcacggcgctggccggcgccggcatcgccttcgag
atcctgtgcctcctggcggagcgggtcgcagcccgcgcctga

DBGET integrated database retrieval system