KEGG   Methylobacterium populi: Mpop_4463Help
Entry
Mpop_4463         CDS       T00760                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mpo  Methylobacterium populi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4758807..4759925)
Genome map
AA seq 372 aa AA seqDB search
MLRAVCPVRRSLRHRMSLGPDSDRDRSFTLAQRSFELMRDYCACATPRAYAVWYLYVSGT
QPLLNDAVKRLTTQNGTLTSADIDGLHDTYIDGRRLAVEVDRMNSSLIAEVEGIMEMIEV
SIRSTAQYGESLQALTHDIANTATSRTRLREIVTTIVANTRDVTANNRTLEARMRESRSE
IETLRETLEAARLESLTDALTGLGNRKSFEEALRRTVDASPTSGHGGKPTSLIVLDIDSF
KRFNDLYGHLTGDQVLRLVAIVMREHVGQTGATLARFGGEEFGIVLPETGLEDARAIAER
VRNGVTGRELVKRSTGESLGKVTVSLGVATQRGDDNAVSLLERADACLFAAKRAGRNRTY
DETEVDALRDVA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggcggtgtgccccgtccgcaggagcctacgtcaccggatgagcctcggcccc
gattccgaccgtgatcgcagtttcacgctcgcgcagcgcagcttcgagctgatgcgcgac
tactgtgcctgcgcgaccccgcgcgcctacgcggtgtggtatctctacgtgtccggcacg
cagccgctgctgaacgatgccgtcaagcggctcaccacgcagaacggcacgctgacgagc
gccgacatcgacgggctccacgacacctatatcgacgggcgccgcctcgccgtggaggtg
gaccggatgaattcgagcctcatcgccgaggtcgagggcatcatggagatgatcgaggtc
tcgatccgctccaccgcccagtacggcgagtcgctccaggctttgacccacgacatcgcc
aacacggccaccagccggacgcgcctgcgcgagatcgtcacgacgatcgtggccaacacc
cgcgacgtgactgccaacaaccgcaccctcgaagcgcggatgcgcgagagccgcagcgag
atcgagaccttgcgcgagacgctggaagcggcccgcctggagagcctgaccgatgccctg
acgggactcggcaaccgcaagagcttcgaggaggcgcttcggcgcaccgtcgatgcgtcg
ccgacctcgggccatggcggcaagccgacgagcctgatcgtgctcgacatcgactccttc
aagcgcttcaacgacctctacggccacctgacgggcgatcaggtgctgcgcctcgtcgcc
atcgtgatgcgcgagcatgtcgggcagacgggcgcgacgctggcccggttcggcggcgag
gagttcggcatcgtcctgccggagaccgggctggaggacgcccgcgccatcgccgagcgg
gtgcgcaacggcgtcaccgggcgcgagctggtgaagcgctcgaccggcgagtcgctcggc
aaggtcacggtctcgctcggcgtcgcgacgcagcggggcgacgacaacgcggtctccctg
ctggaacgggcggatgcctgcctgttcgctgccaagcgcgccggccgcaaccgcacctac
gacgagaccgaggtcgacgccctgcgcgacgtggcgtga

DBGET integrated database retrieval system