KEGG   Methylobacterium populi: Mpop_4475Help
Entry
Mpop_4475         CDS       T00760                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mpo  Methylobacterium populi
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mpop_4475
Enzymes [BR:mpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mpop_4475
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mpop_4475
Lipid biosynthesis proteins [BR:mpo01004]
 Fatty acid synthase
  Component type
   Mpop_4475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4767717..4768373
Genome map
AA seq 218 aa AA seqDB search
MLFFAAATLVGAAGLLPRAARADDSPLKLVALGDSLTAGYRLPADAAFPAVLERALKAKG
YKVEIANAGVSGDTSTGGLDRLDWSVPDGTQGVILELGANDMLRGTDPAVTRKALDTIIA
RLKERNIPVLLAGMLAAPNLGTEYRARFDAIYPDLAKIYGLVLYPFFLDGVAGQRANTMD
DGLHPTAKGVERVVEGILPAVETFLGRLGQQKPEQKGQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcttcgccgcagccacgctcgtcggcgccgcgggtctgctgccccgcgcggcg
cgggccgacgactcacccctcaagctcgtggcgctcggcgacagcctcaccgcgggctac
cgcctgccggccgacgccgcctttcccgccgtgctggagcgggcgctgaaggccaagggc
tataaggtcgagatcgccaatgccggcgtctcgggcgacaccagcaccggcgggctcgac
cggctcgactggtcggtgccggacggcacgcagggcgtgatcctcgaactcggcgccaac
gacatgctgcgcggcaccgatccggcggtgacccgcaaggccctcgacacgatcattgcg
cggctgaaggagcgcaacattccggtgctgctcgccggcatgctcgccgcgcccaatctc
ggcaccgagtaccgcgcccggttcgacgcgatctatcccgatctcgcgaagatctacggc
ctcgtgctctacccgttcttcctcgacggcgtggcgggccagcgcgccaacaccatggat
gacgggctgcaccccaccgccaagggcgtcgagcgggtcgtcgagggcatcctgcccgcc
gtcgagaccttcctgggccgcctcgggcagcagaagccggagcagaagggacagtag

DBGET integrated database retrieval system