KEGG   Methylobacterium populi: Mpop_4528Help
Entry
Mpop_4528         CDS       T00760                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mpo  Methylobacterium populi
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mpo03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4835186..4836076
Genome map
AA seq 296 aa AA seqDB search
MPELPEVETVRRGLAPAMVGARFARVTLRRPNLRFPFPERFAERLEGTTVRELARRAKYL
TAHLDSGESLILHLGMSGRFDVRMPDGSNLSPGDFYLEGALGTPKHDHVVMAFANGATVT
YNDARRFGFMDLVATRDLETCRHFAAMGVEPLSDALDGAVLARLFARKITPLKAALLDQR
LIAGLGNIYVCEALHRSGLHPALPAGALAKPDGAPTPKAKKLVKEIKAVLTEAVAAGGST
LRDYARPDGERGAFQHGFRVYDRVGHACPTKGCTGRIGRIVQGGRSTFFCETCQVR
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactgcccgaagtcgagaccgtgcgccggggcctggcccccgcgatggtcggc
gcgcgcttcgcccgcgtgaccctgcgccggccgaacctgcgcttccccttccccgagcgc
ttcgccgagcggctggagggcacgaccgtgcgggaactggcgcgccgggcgaaatacctc
acggcgcatctcgattccggcgagagcctgatcctgcatctcggcatgagcgggcgcttc
gacgtgcggatgcccgacggctcgaacctctcgccgggcgacttctacctcgaaggggcg
ctcggcacgcccaagcacgaccacgtggtgatggccttcgccaatggcgccaccgtcacc
tacaacgacgcccgccgcttcggcttcatggacctcgtggccacgcgcgatctcgaaacc
tgccgccatttcgcggcgatgggcgtcgagccgctctccgatgcgctcgacggtgcggta
ctcgcgcgcctgttcgcgagaaaaatcacgccgctgaaggccgcgctcctcgaccagcgc
ctgatcgcgggcttaggcaacatctatgtctgcgaggcgctgcaccgctccggcctccac
ccggccctgccggcgggcgcgcttgccaagcccgacggcgccccgacgccgaaggcgaag
aaactcgtcaaggagatcaaggcggtgctcaccgaggcggtggcggcggggggctccacc
ctccgcgactacgcccggccggacggggagcgcggcgccttccagcacggcttccgcgtc
tacgaccgggtgggccatgcctgcccgaccaagggctgcaccgggcggatcggccggatc
gttcagggcggacgctcgacgttcttctgcgagacctgtcaggtccgatag

DBGET integrated database retrieval system