KEGG   Methylobacterium populi: Mpop_4547Help
Entry
Mpop_4547         CDS       T00760                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mpo  Methylobacterium populi
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mpop_4547
Enzymes [BR:mpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mpop_4547
Exosome [BR:mpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mpop_4547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4851490..4852995
Genome map
AA seq 501 aa AA seqDB search
MPDAVGAIDQGTTSTRFIVFDRRGTIRAQAQREHEQIFPRPGWVEHDPREIWRNTHAVMR
EGLARAGLVPGDLAAIGLTNQRETALLWDRRTGEPLHNALVWQDTRTDRTVAALARDGGR
DRFRAVTGLPLASYFSASKLAWLLDHVEGARAKAEDGTALFGTIDSWLVWNLTGGPDGGL
HVTDVTNASRTQLMSLATLDWDEAMLGVFRIPRAVLPEIVSSSAVLGETRDPFPGVPVGG
ILGDQQAALFGQTCFAPGEAKNTYGTGCFALMNTGPEPVASTAGLVTTVAYRLDGRPPAY
ALEGSIAITGALVQWLRDNLGLIGASSEIEGLARSVEDNGGVYVVPAFSGLYAPHWRDDA
RGLIIGLTRYANKGHIARACLEATAYQTREVLEAMERDSGCPLSELRCDGGMTVNDLLMQ
FQADILDRPTLRPKVSETTALGAAYAAGLATGFWKTLEDLRDNWAVDKRWHPHIAAEERR
ALFAGWGRAVERSFGWVEENA
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgccggatgcggtcggggcgatcgatcaaggcaccacgagcacgcgcttcatcgtgttc
gaccgccggggcaccatccgggcgcaggcccagcgcgagcacgagcagatctttccccgc
cccggctgggtcgagcacgacccgcgcgagatctggcgcaacacccatgcggtgatgcgc
gaggggctggcccgggccgggctggtaccgggcgatctggccgcgatcggcctcaccaac
cagcgcgagacggctctgctctgggaccggcggaccggcgagccgctgcacaacgccctc
gtctggcaggacacccgcaccgaccggaccgtcgccgcgctcgcccgcgacggcggccgc
gaccgcttccgcgccgtcaccggcctgccgctggcgagctatttctccgcctccaaactc
gcgtggctgctcgaccacgtggagggggcgcgggccaaggccgaggacggcaccgccctg
ttcggcacgatcgattcctggctcgtctggaatctcacgggcggccccgacggggggctg
cacgtcaccgacgtgaccaatgccagccgtacgcagctgatgtcgctcgcgaccctcgat
tgggacgaggccatgctcggcgtgttccgcatcccgcgggcggtgctgcccgaaatcgtc
tcctcgagcgccgtgctgggcgagacccgcgacccgttccccggcgtgccggtcggcggc
atcctcggcgaccagcaggcggccctgttcgggcagacctgcttcgcgccgggcgaggcc
aagaacacctacggcaccggctgcttcgcgctgatgaacaccggccccgagcccgtcgcc
tcgacggcgggcctcgtcaccaccgtggcctaccggctcgacgggcgtcccccggcctac
gcgctggagggctccatcgccatcaccggcgccctggtgcagtggctgcgcgacaatctc
gggctgatcggcgcgtcgagcgagatcgaggggctcgcccgcagcgtcgaggacaatggc
ggcgtctacgtcgtgccggccttttccggcctctacgccccgcactggcgcgacgacgcc
cgcggcctcatcatcgggctcacccgctacgccaacaagggccacatcgcccgcgcctgc
ctggaggccaccgcctaccagacccgcgaggtgctggaggcgatggagcgcgattccggc
tgcccgctgtccgaactgcgctgcgacggcggcatgaccgtcaacgacctgctgatgcag
ttccaggccgacatcctcgaccggccgaccctgcgcccgaaggtatccgagacgacggcg
ctcggcgcagcttatgccgcggggctggccaccggtttctggaaaacgctcgaagatctt
cgcgacaactgggcggtggacaaacgctggcatccgcatatcgcggcggaagaacgtcgg
gcactctttgccggctggggaagggcggtggaacgctcgttcggctgggtcgaggaaaac
gcttga

DBGET integrated database retrieval system