KEGG   Methylobacterium populi: Mpop_4607Help
Entry
Mpop_4607         CDS       T00760                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mpo  Methylobacterium populi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpop_4607
   00030 Pentose phosphate pathway
    Mpop_4607
   00051 Fructose and mannose metabolism
    Mpop_4607
   00052 Galactose metabolism
    Mpop_4607
   00500 Starch and sucrose metabolism
    Mpop_4607
   00520 Amino sugar and nucleotide sugar metabolism
    Mpop_4607
  Nucleotide metabolism
   00230 Purine metabolism
    Mpop_4607
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mpop_4607
Enzymes [BR:mpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mpop_4607
    5.4.2.8  phosphomannomutase
     Mpop_4607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4916881..4918431
Genome map
AA seq 516 aa AA seqDB search
MSSDRFPKTFSKASPMTFPTPRPKLEPNTFAFEQLPMVKPTGFREYDARWLFPQEINLMG
VQALGLGLGTLIHERGVRPDIVTGHDFRSYSSAIKLALIAGMQAAGLRVKDIGLALSPMA
YFGQFALDCPCVAMVTASHNDNGWTGVKMGAERPMTFGPDEMGRLKEIVTTGAFQYRDGG
AYEFVPDFAQVYLDDLVARAKPVSRKLKVVAACGNGTAGAFAPALLERLGVEVIPLDVEP
DHSFPRYNPNPEDMAMLHAIADKVRETGADVGLGFDGDGDRCGVVDDEGEEIFADKIGVM
LARDLSKLHPNATFVVDVKSTGLYAADPELQARGVRTDYWKTGHSYIKRRVNELSALAGF
EKSGHFFFNAPVGRGYDDGLLTAIAVIEMLDRNPDRSMADLYRALPKTWGSPTMSPHCAD
EVKYGVVAAVTERFRALHAAGEPVGGHAITDLVTVNGVRVTTDDGTWGLVRASSNKPELV
VVVESPVSEARLREMFAAVDAVLREHPDVGAYNQTI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgaccggtttcccaagaccttctccaaggcctcccccatgacctttcccacg
ccccggccgaagctcgagcccaacaccttcgccttcgagcagttgccgatggtcaagccc
accggctttcgcgagtacgatgcccgctggctgttcccgcaggagatcaacctcatgggc
gtccaggcgctgggcttaggcctcggcaccctgatccatgagcgcggcgtgcgccccgac
atcgtcaccggacacgacttccgcagctactcctccgcgatcaagctcgcgctcatcgcc
ggcatgcaggcggccgggctgcgggtgaaggatatcgggctggcgctttcgcccatggcc
tatttcggccagttcgccctcgattgtccctgcgtggccatggtcaccgcctcgcacaac
gacaacggctggaccggcgtgaagatgggcgccgagcggccgatgaccttcggccccgac
gagatgggccgcctgaaggagatcgtcaccacgggcgcgttccagtaccgcgacggcggt
gcctacgaattcgtgccggacttcgcgcaggtctacctcgacgacctcgtggcccgcgcc
aagcccgtctcgcgcaaactcaaggtcgtggccgcctgcggcaacggcaccgccggcgcc
ttcgcgcctgccctgctggagcggctcggggtcgaggtgatcccgctcgacgtcgagccc
gatcattcgttcccgcgctacaaccccaaccccgaggacatggcgatgctgcacgccatc
gccgacaaggtgcgcgagaccggcgccgatgtcgggctcggcttcgacggcgacggcgac
cgctgcggcgtggtcgacgacgagggcgaggagatcttcgccgacaagatcggggtgatg
ctggcgcgcgacctgtcgaagctgcatccgaacgcgaccttcgtggtcgatgtgaagtcg
accggcctctacgccgccgatcccgagcttcaggcccgcggcgtgcgcaccgattactgg
aagacggggcattcctacatcaagcgccgggtcaacgagctctcggcgctggccggcttc
gagaagtcggggcacttcttcttcaacgcgccggtggggcggggctacgacgacggcctg
ctgaccgcgattgcggtgatcgagatgctcgaccgcaacccggatcgctcgatggccgat
ctctaccgggcgctgccgaagacctggggctcgccgacgatgtcgccgcactgcgccgac
gaggtgaagtacggcgtggtggcggcggtgaccgagcggttccgggcgctgcacgcggcg
ggcgagccggtggggggccatgcgatcaccgatctggtgacggtcaacggcgttcgggtg
acgacggacgacggcacctggggtctggtgcgggcctcctcgaacaagccggaactggtg
gtggtggtggagagcccggtctcggaggcgcggctgcgggagatgtttgccgccgtcgac
gcggtcctgcgcgagcacccggacgtcggcgcctacaaccagacgatctga

DBGET integrated database retrieval system