KEGG   Methylobacterium populi: Mpop_4640Help
Entry
Mpop_4640         CDS       T00760                                 

Definition
glucosamine--fructose-6-phosphate aminotransferase
Orthology
K00820  
glucosamine--fructose-6-phosphate aminotransferase (isomerizing) [EC:2.6.1.16]
Organism
mpo  Methylobacterium populi
Pathway
Alanine, aspartate and glutamate metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Mpop_4640
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mpop_4640
Enzymes [BR:mpo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.16  glutamine---fructose-6-phosphate transaminase (isomerizing)
     Mpop_4640
Peptidases [BR:mpo01002]
 Cysteine Peptidases
  Family C44
   Mpop_4640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4952384..4954210
Genome map
AA seq 608 aa AA seqDB search
MCGIVGIVGRDSVADALVEALRRLEYRGYDSAGIATLERGRLDRRRAEGKLSNLQRKLVE
TPLPGAIGIGHTRWATHGRPNETNAHPHATGRLAVVHNGIIENFRELKNELEAAGARFES
ETDTEVVAQLVSHLMDQGLGPVAAVAAALPRLHGAFALAFLFAGEEDFLIGARHGAPLAI
GYGQGETYLGSDALALAPFTDEITYLEEGDWAILTRDGAEIRDIAGNLARRPRQRIATQA
YLVDKGNHRHFMAKEIHEQPEVVGRTLAHYVDMARGQVVLREALPFDFARLSRLSITACG
TAYYAGLVAKYWFETLARLPVEIDVASETRYREPPLERDGLTLVISQSGETADTLASLRY
AKAQGQHTLAVVNVPTSTIARESSAVMPTFAGPEIGVASTKAFSCQLTVLLCLALAAGRA
RGTLSAERERAIVDALITAPGLMAEAVTMEAAIEGLAREIAKARDVLYLGRGTSYPMALE
GALKLKEISYIHAEGYAAGELKHGPIALIDESVPVIVIAPHDAIFEKTVSNMQEVAARGG
RIILVGDAKGAAAAGLETLATLTMPEVDPVIAPIVYAVPIQLIAYHTAVFMGKDVDQPRN
LAKSVTVE
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcgtcggcatcgtcgggcgtgactcggtcgcggatgcgctggtcgaggcg
ctgcggcggctcgaatatcgcggttacgactcggccggcatcgccaccctggagcgcggc
cggctcgaccgccgccgggccgagggcaagctctcgaacctccagcgcaagctggtcgag
acgccgcttcccggcgccatcggcatcggccatacccggtgggccacccacggacgcccc
aacgagaccaacgcccacccgcacgccaccgggcggctggcggtggtccataacggcatc
atcgagaactttcgcgagctgaagaacgaattggaggcggcgggggcgcgcttcgagagc
gagaccgacaccgaggtcgtggcgcaactcgtcagccatctgatggaccaggggctcggc
ccggtggccgcggtcgcggcggcgctgccgcgcctgcacggcgccttcgccctggccttc
ctgttcgcgggcgaggaggacttcctgatcggcgcccgtcacggcgcgccgctcgccatc
ggctacgggcagggcgagacctatctcggctcggacgcgctggcgctggcaccgttcacc
gacgagatcacctatctcgaagagggcgactgggcgatcctgacccgtgacggcgccgaa
atccgggacatcgccggcaacctcgcacgccggccgcgccaaagaatcgcgacgcaggcc
tacctcgtggacaagggcaaccaccgccacttcatggcgaaggagatccacgagcagccc
gaggtcgtcggccgcacgctcgcccactacgtcgacatggcgcgcggccaggtcgtgctg
cgggaggcgctgcccttcgatttcgcccgtctctcgcgcctctcgatcaccgcctgcggc
accgcctactatgccggcttggtcgccaagtactggttcgagaccctggcgcggctgccg
gtcgagatcgacgtcgcctccgagacccgttaccgcgagccgccgctggagcgggacggg
ctgacgctcgtgatctcgcaatcgggcgagaccgccgacacgctcgcttcgctgcgctac
gccaaggcgcagggccagcacacgctggcggtggtcaacgtgccgacctccaccatcgcc
cgcgaatcctcggcggtgatgccgaccttcgccggccccgagatcggggtggcctccacg
aaggccttctcctgtcagctcacggtgctgctctgcctcgcgctcgccgcggggcgtgcc
cgcggcacgttgagcgccgagcgcgagcgcgccatcgtcgatgcgctgatcaccgccccc
ggcctgatggccgaggcggtgacgatggaggcggcgatcgaggggctcgcccgcgagatc
gccaaggcccgcgacgtgctctatctcgggcgcggcacgagctatccgatggcgctggaa
ggcgccctgaagctcaaggaaatcagctacatccacgctgagggctacgcggcgggcgaa
ctcaagcacgggccgatcgccctgatcgacgagagcgtgccggtgatcgtgatcgcgccg
catgatgcgatcttcgagaagaccgtctcgaacatgcaggaggtcgccgcccgcggcggc
cggatcatcctcgtcggcgatgccaagggcgcggcggcggcggggctcgaaaccctggcg
acgctgaccatgccggaggtggacccggtgatcgcgccgatcgtctacgccgtgccgatc
cagctcattgcctatcacaccgccgtcttcatgggcaaagacgtcgaccagccgcgcaat
ctggcaaagtccgtcaccgtggagtga

DBGET integrated database retrieval system