KEGG   Methylobacterium populi: Mpop_4751Help
Entry
Mpop_4751         CDS       T00760                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mpo  Methylobacterium populi
Brite
Enzymes [BR:mpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mpop_4751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD Methyltransf_31 CMAS GCD14
Motif
Other DBs
NCBI-ProteinID: ACB82847
JGI: Mpop4751
UniProt: B1ZJ08
Position
complement(5076269..5076955)
Genome map
AA seq 228 aa AA seqDB search
MPSEAGDPDGVADGLAAATGNAAFVLALRERGVRDTAVLRAMERVPRERFAPPALRAHAR
RDIALPLACGQTMTAPSIVAAMLGALDIAPGARVLEVGTGTGYVTALLVQLGAAHVRSLE
RYDGLARAARSHLGRDFDAAAVETTDGLAPEVVRGGSYDRILVNGSLAALPPHLPAVLRS
GGRLVAGQWTGRGSRLVTLTRDGAAAYARTEGAALRLGPLTPGRALAP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaggccggcgatcccgacggggtggcggacgggctcgccgcggcgaccggc
aacgccgccttcgttctggccctgcgcgagcggggcgtgcgcgacaccgccgtgctgcgg
gcgatggagcgggtgccgcgggagcgcttcgccccgcccgccctgcgcgcccatgcaagg
cgcgacatcgccctgccgcttgcctgcggccagaccatgaccgcgccgagcatcgtcgcg
gccatgctcggcgccctcgacatcgcccccggcgcgcgggtgctggaggtcggcacgggc
acgggctacgtcaccgccctgctggtgcagctgggcgccgcccatgtgcgcagcctggag
cgctacgacggccttgcccgcgccgcgcggagccatctcgggcgcgacttcgatgccgcc
gccgtcgagaccaccgacgggctcgctccggaggtcgtgcggggcggcagctacgaccgc
atcctcgtcaacggcagcctcgccgcgctgccgccgcaccttcccgccgtcctcagatcc
ggcggccggctggtggcgggccaatggaccgggcgggggagccggctggtgacgctgacc
cgcgacggcgcggcggcctacgcccgcacggaaggcgcggccctgcgcctcggtccgctg
acgcccggtcgcgccctcgcgccgtag

DBGET integrated database retrieval system