KEGG   Methylobacterium populi: Mpop_4779Help
Entry
Mpop_4779         CDS       T00760                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mpo  Methylobacterium populi
Brite
Enzymes [BR:mpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mpop_4779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_11 MTS CMAS SAM_MT Methyltransf_32 Methyltransf_12 Methyltransf_23 Methyltr_RsmB-F GCD14 RrnaAD ACP_syn_III_C Methyltransf_24 DUF938
Motif
Other DBs
NCBI-ProteinID: ACB82875
JGI: Mpop4779
UniProt: B1ZJW1
Position
5105470..5106108
Genome map
AA seq 212 aa AA seqDB search
MTDAARARMLETQLIARGIRDAALLDAMGRVAREAFVPAEFAAEAYADGPLPIGAGQTIS
QPYIVALMIEALALRPGERVLEVGAGCGYAAAVLATMGARIFAIERHAALAEAARARLAA
LGLAVRLRVGDGHAGWPEAAPFDAILVSAAGSAVPEALKRQLAQGGRLVIPVGPPGGQTL
LRLTRRGPERFESRDFGPVSFVPLLRGVGAAG
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
gtgacggatgccgcccgcgcccggatgctcgagacgcagctgatcgcccgcggcatccgc
gacgcggctctcctcgacgcgatgggacgggtggcgcgcgaggccttcgtcccggccgag
ttcgcggcggaagcctatgccgacgggccgctgccgatcggtgcggggcagacgatctcg
cagccctacatcgtcgccctgatgatcgaggcgctggcgctgcggcccggcgagcgggtg
ctggaggtcggcgccggctgcggctacgcggcggccgtgctggccacgatgggcgcacgg
atcttcgccatcgagcgccacgccgccctggccgaggccgcccgcgcgcgcctcgccgcc
ctcggcctcgcggttcgcctgcgcgtcggcgacgggcatgcgggctggccggaggccgcg
cccttcgacgcgatcctcgtctcggcggcgggttccgcggtcccggaggcgctgaagcgc
caactcgcgcagggcgggcgcctcgtcatcccggtcggcccgccgggcgggcagacgcta
ctgcggctgacccggcgcggcccggagcggttcgagagccgcgatttcggcccggtctcg
ttcgtgccgctgctgcggggcgtgggggcggcgggataa

DBGET integrated database retrieval system