KEGG   Methylobacterium populi: Mpop_4908Help
Entry
Mpop_4908         CDS       T00760                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mpo  Methylobacterium populi
Pathway
mpo00010  Glycolysis / Gluconeogenesis
mpo00052  Galactose metabolism
mpo00500  Starch and sucrose metabolism
mpo00520  Amino sugar and nucleotide sugar metabolism
mpo00521  Streptomycin biosynthesis
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01200  Carbon metabolism
Module
mpo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpop_4908
   00052 Galactose metabolism
    Mpop_4908
   00500 Starch and sucrose metabolism
    Mpop_4908
   00520 Amino sugar and nucleotide sugar metabolism
    Mpop_4908
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mpop_4908
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mpop_4908
Enzymes [BR:mpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mpop_4908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ACB83004
JGI: Mpop4908
UniProt: B1ZL05
Position
complement(5246073..5247074)
Genome map
AA seq 333 aa AA seqDB search
MFEFPVLIGDIGGTNARFGLIETKGAPPRLLSREATHGHPHPSAAIRASLAQAGGPAPRS
AILAIAGRVDAPAVQLTNADWLVDATAIGRDFGLDRVALVNDYVPVAAGAAGIAPDELTP
IGPEIGEARGPRLVLGPGTGFGAAALIPYEDRLAIVSTEAGHTDLGPTDAEEAELWPAVE
RVEGRVTVETLLSGPGLARLCAAIRTVRAGGDGSLCDPAEITSSGLSGADPHAHAALALF
GKLLGRVCGDLALTFLAAGGVYIGGGIAPRIVSILREGAFREAFERKAPFAEQMRSIPTS
VITVKDPAFSGLAALASESGRFVYHGQAWTPGS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttcgaattcccggtgctgatcggcgatatcggcgggacgaatgcccgcttcggcctg
atcgagacgaagggcgcgccgccgcggctcctctcccgcgaggcgacccacggccatcct
catccgagcgcggcgatccgggcctccctggcccaggccggcggacccgcgccgcgctcg
gcgatcctggcgatcgcgggccgggtcgatgcccccgcggtccagctcaccaatgccgac
tggctggtggatgccacggccatcggacgggatttcgggctcgaccgggtcgccctcgtc
aacgattacgtgccggtcgccgccggcgcggccggcatcgcgcccgacgaactgaccccg
atcggcccggagatcggcgaggcccgcggtccccgtctcgtgctcgggccgggcaccggt
ttcggtgccgccgcgctgatcccctacgaggatcgtctcgccatcgtctcgacggaggcc
ggccacaccgatctcggaccgacggatgccgaggaagcggagctttggccggcggtggag
cgcgtcgaggggcgggtgaccgtggagacgctgctctccggtccgggcctcgcccggctc
tgcgccgcgatccgcacggtgcgggcgggtggcgacggctccctgtgcgatccggccgag
atcacgagcagcggcctctcgggcgcggatccgcacgcgcacgccgcgctcgccctgttc
ggcaagctcctgggccgggtctgtggggatctggcgctcaccttcctcgccgccggcggg
gtctatatcggcggcggcattgccccgcggatcgtttcgatcctgcgggagggcgccttc
cgagaggcgttcgagcgcaaggcgcccttcgccgagcagatgcggagcatccccaccagc
gtcatcaccgtgaaggacccggccttcagcggcctcgcggccctggccagcgagagcggg
cgcttcgtctaccacgggcaggcctggaccccggggagctaa

DBGET integrated database retrieval system