KEGG   Methylobacterium populi: Mpop_5177Help
Entry
Mpop_5177         CDS       T00760                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mpo  Methylobacterium populi
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mpop_5177
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mpop_5177
Enzymes [BR:mpo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Mpop_5177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5544257..5545720)
Genome map
AA seq 487 aa AA seqDB search
MSQPTLADLFPEADAAIAARPVAGLTADSRRVVPGGVFVAVPGTAADGRLFAAAAARAGA
VAVAGEGTRPTDLPEATAWIEVAEARRALALAAARLSGRQPETVVAVTGTSGKSSVADFV
RQILSRLGRESASLGTVGIVTNRGAEYGSLTTPDPVTLHQTLARLAGEGITDLAMEASSH
GIEQRRLDGVALTAAAFTNLGRDHLDYHPTVEDYLEAKLRLFTTLLPKGRPAIVNADGAY
AERVIGVADAAGHTVLTTGRSGDFIRLIESGTVGFSQSLTLAHDGREYRVRLPLVGGFQV
ENALVAAGLALSTQAGAADPAGVFAALEGLTGVPGRMERIGEANGGLCLVDYAHKPEALE
HVLTALRPFASGQLVVVFGCGGNRDAGKRPIMGAIAERLADRVIVTDDNPRNEEPAAIRA
AILAAAPGAEEIGDRAEAIRAGVRGLRAGDVLVVAGKGHETGQIVGSRVLPFSDHDTLRA
AIAELNK
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccgacgcttgctgacctgtttccggaggcggacgcggcgattgccgcccgc
cccgtcgccggcctcaccgccgacagccgccgggtcgtgcccggcggcgtgttcgtggcc
gtgcccggcaccgccgccgacggccggctcttcgccgccgcggcagcccgggccggcgcg
gtcgccgtggccggggaggggacgcggccgacggacctgcccgaggcgacggcctggatc
gaggtggcggaagcccgtcgcgccctggcgctcgccgccgcccggctgtccggacgccag
ccggagacggtggtggcggtgaccggcaccagcggcaagagttcggtcgccgacttcgtg
cgccagatcctgtcgcggctcggccgggaatcggcgagcctcggcacggtcggcatcgtc
accaaccggggcgcggaatacggctcgctgacgacgcccgatcccgtcacgctgcaccag
accctggcgcggctggcgggggaggggatcaccgatttggccatggaggcctcctcccac
ggcatcgagcagcgccgcctcgacggggtggcgctgacggccgccgccttcaccaatctc
ggccgcgatcacctcgactaccatccgaccgtcgaggactatctggaagccaagctccgg
ctgttcacgacgctgctgccgaagggccgcccggccatcgtcaatgccgacggcgcctat
gccgaacgcgtcatcggcgtcgccgatgccgccggacacacagttctgaccacggggcgc
agcggcgacttcatccgcctgatcgagtcggggacggtcggattttcccaatcgctgacg
ctcgcccatgacggccgggagtaccgcgtgcgcctgccgctggtgggcggcttccaggtc
gagaacgccttggtcgccgcaggcctcgccctgtcgacgcaggcgggcgcggccgatccg
gcgggtgtcttcgcggccctcgaagggctgaccggcgtgccgggccggatggagcggatc
ggcgaggcgaacgggggtctgtgcctcgtcgattacgcccataagccggaggcgctggaa
cacgttctgacggcgctccgcccctttgccagcgggcagctcgtcgtggtgttcggctgc
ggcggcaaccgcgatgccggcaagcggccgatcatgggtgccatcgccgagcgcctcgcc
gatcgggtgatcgtcaccgacgacaacccccgcaacgaggagcccgccgcgatccgcgcc
gcgatcctcgccgcggcaccgggagcggaggagatcggcgaccgggcggaggcgatccgc
gcaggcgtgcgcggcttgagagccggcgatgtgctggtggtggccggcaaaggtcatgaa
accggccagatcgtcgggtcacgcgtgctgccgttctcggatcacgacaccctgcgcgcc
gcgatcgcggagttgaacaaatga

DBGET integrated database retrieval system