KEGG   Methylobacterium populi: Mpop_5197Help
Entry
Mpop_5197         CDS       T00760                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mpo  Methylobacterium populi
Pathway
mpo00230  Purine metabolism
mpo00240  Pyrimidine metabolism
mpo01100  Metabolic pathways
mpo03030  DNA replication
mpo03430  Mismatch repair
mpo03440  Homologous recombination
Module
mpo_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mpop_5197
   00240 Pyrimidine metabolism
    Mpop_5197
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mpop_5197
   03430 Mismatch repair
    Mpop_5197
   03440 Homologous recombination
    Mpop_5197
Enzymes [BR:mpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Mpop_5197
DNA replication proteins [BR:mpo03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Mpop_5197
DNA repair and recombination proteins [BR:mpo03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Mpop_5197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi Germane
Motif
Other DBs
NCBI-ProteinID: ACB83291
JGI: Mpop5197
UniProt: B1Z9Q5
Position
complement(5564880..5565332)
Genome map
AA seq 150 aa AA seqDB search
MTEILFYHLQRQPLEKVLPNLLEKSLERGWQAAIQAVSEERLQALDDGLWTYTDESFLPH
GTDRDTDAASQPVVLTLRETNPNAASIRFLVEGAELPEDAGSYQRICILFDGTDTDALLH
AREQWRGAKAAGHAVAYWQQDESGRWTKKA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgagatcctgttctaccaccttcagcgccagcccctcgaaaaggtgctgcccaac
ctcctcgagaagtcgctggagcgcggctggcaggcggccatccaggcggtgagcgaggag
cggctccaggcgctcgacgacggcctctggacctataccgacgagagtttcctgccccat
gggaccgaccgcgacacggatgcggcgagccaaccggtggtgctgaccctgcgggagacc
aatcccaacgccgcctcgatccgtttcctcgtcgagggcgcggaactgccggaggatgcg
ggcagctaccagcgcatctgcatcctgttcgacggcaccgacaccgacgcgctgctccat
gcccgcgagcagtggcgcggcgccaaggccgccggccacgcggtcgcctactggcagcag
gacgagagcgggcgctggaccaagaaggcgtga

DBGET integrated database retrieval system