KEGG   Methylobacterium populi: Mpop_5206Help
Entry
Mpop_5206         CDS       T00760                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpo  Methylobacterium populi
Pathway
mpo00010  Glycolysis / Gluconeogenesis
mpo00051  Fructose and mannose metabolism
mpo00562  Inositol phosphate metabolism
mpo00710  Carbon fixation in photosynthetic organisms
mpo01100  Metabolic pathways
mpo01110  Biosynthesis of secondary metabolites
mpo01120  Microbial metabolism in diverse environments
mpo01130  Biosynthesis of antibiotics
mpo01200  Carbon metabolism
mpo01230  Biosynthesis of amino acids
Module
mpo_M00002  Glycolysis, core module involving three-carbon compounds
mpo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpop_5206
   00051 Fructose and mannose metabolism
    Mpop_5206
   00562 Inositol phosphate metabolism
    Mpop_5206
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mpop_5206
Enzymes [BR:mpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mpop_5206
Exosome [BR:mpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mpop_5206
  Exosomal proteins of bladder cancer cells
   Mpop_5206
  Exosomal proteins of melanoma cells
   Mpop_5206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM CutC
Motif
Other DBs
NCBI-ProteinID: ACB83300
JGI: Mpop5206
UniProt: B1Z9R4
Position
complement(5571391..5572155)
Genome map
AA seq 254 aa AA seqDB search
MASEGRRPLVAGNWKMNGLRSSVPTVEAIRDGLPPALTDKIDVLICPPATLISSCVAAVY
GSPVAIGGQNLHARPSGAFTGSISAEMFADLGATYVIVGHSERRAYHYETDDGVHAKALG
ARRAGLRGIICVGETMEERQQGRALDIVRAQLAIGLPKGATGDDTVIAYEPVWAIGSGRT
PTAKEIAEVHASLREMLDKLVGEEAHKIRILYGGSVKPSNARELMAVENVDGALVGGASL
VAEDFLGICRAYEE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagggacgccgtccgctggttgccggcaactggaagatgaacggtctgcgc
tcctcggttccgaccgtcgaggcgatccgcgacgggctcccgcccgcgctcacggacaag
atcgacgtgctgatctgtccgcccgcgaccctgatctcctcctgcgtcgccgcggtctac
ggctcgcccgtcgccatcggcggccagaacctgcatgcccgcccaagcggcgccttcacc
ggctcgatctcggcggagatgttcgccgatctcggcgcgacctacgtcatcgtcggccat
tccgaacggcgcgcctaccattacgagaccgatgacggcgtccacgccaaggcgctgggc
gcccgccgcgccggcctgcgtggcatcatctgcgtcggcgagaccatggaggagcgccag
cagggccgggcgctcgacatcgtccgcgcgcagctcgccattggcctgccgaagggcgcc
accggcgacgacacggtgatcgcctacgagccggtctgggcgatcggctcgggccgcacg
ccgacggcgaaggagatcgccgaggtccatgcctccctgcgcgagatgctcgacaagctc
gtcggcgaggaggcgcacaagatccgcatcctctacggcggctcggtgaagccttccaac
gcccgcgagttgatggcggtggagaacgtcgacggcgcgctcgtcggcggcgccagcctc
gtggcggaggactttttggggatctgccgcgcctacgaggaatag

DBGET integrated database retrieval system