KEGG   Methylobacterium populi: Mpop_5206Help
Entry
Mpop_5206         CDS       T00760                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mpo  Methylobacterium populi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mpop_5206
   01230 Biosynthesis of amino acids
    Mpop_5206
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mpop_5206
   00051 Fructose and mannose metabolism
    Mpop_5206
   00562 Inositol phosphate metabolism
    Mpop_5206
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mpop_5206
Enzymes [BR:mpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mpop_5206
Exosome [BR:mpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mpop_5206
  Exosomal proteins of bladder cancer cells
   Mpop_5206
  Exosomal proteins of melanoma cells
   Mpop_5206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5571391..5572155)
Genome map
AA seq 254 aa AA seqDB search
MASEGRRPLVAGNWKMNGLRSSVPTVEAIRDGLPPALTDKIDVLICPPATLISSCVAAVY
GSPVAIGGQNLHARPSGAFTGSISAEMFADLGATYVIVGHSERRAYHYETDDGVHAKALG
ARRAGLRGIICVGETMEERQQGRALDIVRAQLAIGLPKGATGDDTVIAYEPVWAIGSGRT
PTAKEIAEVHASLREMLDKLVGEEAHKIRILYGGSVKPSNARELMAVENVDGALVGGASL
VAEDFLGICRAYEE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagggacgccgtccgctggttgccggcaactggaagatgaacggtctgcgc
tcctcggttccgaccgtcgaggcgatccgcgacgggctcccgcccgcgctcacggacaag
atcgacgtgctgatctgtccgcccgcgaccctgatctcctcctgcgtcgccgcggtctac
ggctcgcccgtcgccatcggcggccagaacctgcatgcccgcccaagcggcgccttcacc
ggctcgatctcggcggagatgttcgccgatctcggcgcgacctacgtcatcgtcggccat
tccgaacggcgcgcctaccattacgagaccgatgacggcgtccacgccaaggcgctgggc
gcccgccgcgccggcctgcgtggcatcatctgcgtcggcgagaccatggaggagcgccag
cagggccgggcgctcgacatcgtccgcgcgcagctcgccattggcctgccgaagggcgcc
accggcgacgacacggtgatcgcctacgagccggtctgggcgatcggctcgggccgcacg
ccgacggcgaaggagatcgccgaggtccatgcctccctgcgcgagatgctcgacaagctc
gtcggcgaggaggcgcacaagatccgcatcctctacggcggctcggtgaagccttccaac
gcccgcgagttgatggcggtggagaacgtcgacggcgcgctcgtcggcggcgccagcctc
gtggcggaggactttttggggatctgccgcgcctacgaggaatag

DBGET integrated database retrieval system