KEGG   Methylobacterium populi: Mpop_5212Help
Entry
Mpop_5212         CDS       T00760                                 

Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mpo  Methylobacterium populi
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mpop_5212
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mpop_5212
Enzymes [BR:mpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Mpop_5212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5579646..5580503
Genome map
AA seq 285 aa AA seqDB search
MDDIVADVTVGPATTAPERASVLARIEAYKRREIAEAKLRVPLAKLEKQVAKAEPPRGFA
DAIAAHIAEGRPALIAEIKKASPSKGLIRADFDPKTLAEAYARGGATCLSVLTDTPSFQG
APDFLTEARAACDLPVLRKDFLFEPYQVYEARAWGADCVLVIMACLDDAEAAAITETAHD
LGMDVLVEVHDAEELERALPLGTRLVGVNNRNLKTFEVSFETAIRLKPGIPADRIAVAES
GIGGHADVLRLKQHGLDTILVGESLMRQADVTAATRALLFGDARR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggacgacatcgtggccgacgtgaccgtcgggcctgccacgaccgcccccgagcgggcg
agcgtgctggcgcggatcgaagcctacaagcgccgcgagatcgccgaggcgaagctgcgc
gtgccgctggccaagcttgagaagcaggtggctaaagccgaaccgccccgcggcttcgcc
gacgccatcgccgcccatatcgcggaaggccgcccggccctcatcgccgagatcaagaag
gcttcgccctccaaggggctgatccgcgccgatttcgacccgaagacgctggccgaagcc
tatgccaggggcggcgccacctgcctctcggtgctcaccgatacgccctccttccagggc
gcgccggatttcctcaccgaggcccgtgcggcctgcgacctgccggttctgcgcaaggat
tttctgttcgagccctatcaggtctacgaggcccgagcctggggcgccgattgcgtcctc
gtcatcatggcctgcctggacgacgccgaggccgccgccatcaccgagaccgcgcacgat
ctcggcatggacgtgctggtggaggttcacgacgccgaggaattggagcgggccctgccg
ctcggcacccggctcgtcggcgtcaacaaccgcaacctcaagaccttcgaggtctcgttc
gagacggcgatccggctcaagcccggcattcccgccgaccgtattgcggtcgccgagagc
ggcatcggcggacatgccgacgtgctgcgcttgaagcagcatgggctcgacaccatcctc
gtcggcgagagcctgatgcggcaggccgacgtcaccgcggcgacgcgggcgctgctgttc
ggggatgccagacggtga

DBGET integrated database retrieval system