KEGG   Methylobacterium populi: Mpop_5240Help
Entry
Mpop_5240         CDS       T00760                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mpo  Methylobacterium populi
Brite
Enzymes [BR:mpo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mpop_5240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5610660..5611310)
Genome map
AA seq 216 aa AA seqDB search
MLDYAQARRLMVDCQLRTFDVNDVAVLDAFDSVPRERFVPQGREDFAYIDQTLTFDAGED
GTRAMPAPMVLARMIQALKIRPGDRALDVGTGYGYGAAILRRLGAEVVALESAADLVGAA
RERLGGDAAIVQGSLSAPVKDGPFDAILVEGRVEVRPQALLDQLRDEGRLVCVLGPHRSA
KATLFVRAGDAFGSRSLFDASLPALKSFANEPGFAF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctcgattatgcccaggcgcggcgcctcatggtcgattgccagctccggaccttcgac
gtgaacgacgttgcggtgctcgacgcgttcgactccgtgccccgtgagcgcttcgtcccg
cagggccgcgaggacttcgcctatatcgaccagacgctgaccttcgacgcgggcgaggac
gggacccgcgcgatgccggcgccgatggtgctggcgcgcatgatccaggccctcaagatc
cgccccggcgaccgcgccctcgatgtcggcaccggctacggttacggcgcggccatcctg
cgccgcctcggcgccgaggtcgtcgccctcgaatccgccgcggatctcgtcggtgccgcc
cgcgagcgcctgggcggcgacgccgcgatcgtccaaggcagcctgtccgcgccggtcaag
gacggccccttcgacgcgattctcgtcgagggccgcgtcgaggtgcggccgcaggccctg
ctcgaccagttgcgcgacgagggacgcttggtctgcgtgctcggtccgcaccgcagcgcc
aaggcgaccctgttcgtacgggcgggcgatgcgttcggctcccgctcgctgttcgatgcg
tcgctgcctgccctcaagagcttcgcgaacgaacccggcttcgccttctga

DBGET integrated database retrieval system