KEGG   Methylobacterium populi: Mpop_5267Help
Entry
Mpop_5267         CDS       T00760                                 

Definition
(GenBank) Malonyl-CoA decarboxylase
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mpo  Methylobacterium populi
Pathway
mpo00410  beta-Alanine metabolism
mpo00640  Propanoate metabolism
mpo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mpop_5267
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mpop_5267
Enzymes [BR:mpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Mpop_5267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCD MCD_N
Motif
Other DBs
NCBI-ProteinID: ACB83361
JGI: Mpop5267
UniProt: B1ZAN8
Position
5633098..5634507
Genome map
AA seq 469 aa AA seqDB search
MAAISFLGDLIQTISDRGRDLIGLARTDLARTASAADLARLCEDLISRRGEASGVALARL
ILDRYASFPEGERLAFLELVATEFGADHDAVDAAIAAYRAEPTRARLGRLHDAAEPRSQE
LIRRLNLARGGTLALVRMREDLFALRKHLKDRGAAPETIDAAVSLDSDFEHLFASWFNRG
FLVLRHIDWSTPAHILEKIIRYEAVHEIADWDELRRRIEPTDRRCFAFFHPALLDEPLIF
VEVALTNAIAPAIQPILADGRQPVPARTATTAIFYSISNCQKGLAGVTFGNFLIKQVVED
LAREIPSLKTFVTLSPVPGFRTWLDRERGADAPQGLTREDVETLRLLESDDWRSDKAKCE
AVRRAMLPAVAAYFLRAKNERGRPLDPVARFHLGNGARLERMNFLGDTSKKGLKQSYGLM
VNYLYDLSAIEKNHETYVNLGTVATSSAVSRELRSNLPPPRAVVLAEAG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatctcgttcctcggcgatctcatccagaccatcagcgaccgcggccgcgat
ctcattggtctcgcccgcaccgatctggctcggacggcaagtgcggcggatctcgctcgc
ctctgtgaggatctgatctcccggcgcggcgaagcctccggggtggcgctggcccggctg
atcctcgatcgctacgccagcttccccgagggcgagcgcctcgccttcctcgaactcgtc
gcgaccgagttcggtgccgaccacgacgcggtcgatgcggcgattgcggcctaccgcgcc
gagccgacgcgcgcccgcctcggccggctgcacgatgcggccgagccccgctcgcaggaa
ctgatccgccgcctcaacctcgcccgcggcggtaccctggcgctggtgcggatgcgcgag
gatctgttcgccctgcgcaagcacctgaaggaccggggcgccgcccccgagacgatcgac
gccgcggtgagcctcgacagcgatttcgagcacctgttcgcctcgtggttcaaccggggc
ttcctggtgctgcgccacatcgactggtcgacgccggcccacatcctcgagaagatcatc
cgctacgaggcggtccacgagatcgccgattgggacgagctgcgccgccgcatcgaaccg
acggaccggcgctgcttcgccttcttccaccccgccctgctcgacgagccgctgatcttc
gtcgaggtggcgctcacgaacgccatcgctccggcgatccaaccgattctcgccgacggg
cgccagccggtgccggcacggaccgccaccaccgcgatcttctactcgatctcgaactgc
cagaagggtctggccggcgtcaccttcggcaacttcctcatcaagcaggtcgtggaggat
ctcgcccgcgagattccctcgctcaagaccttcgtcaccctctcgcccgtgcccggcttc
cgcacctggctcgaccgggagcgcggcgccgacgcgccgcagggcctgacgcgggaggac
gtcgagaccctgcgcctgctcgaatccgacgattggcgcagcgacaaggcgaagtgcgag
gccgtgcggcgcgccatgctgccggcggtggccgcctacttcctgcgcgccaagaacgag
cggggccgcccgctcgacccggtcgcccgcttccatctcggcaacggggcgcggttggag
cggatgaacttcctcggcgacacctcgaagaagggcctgaagcagtcctacggcctgatg
gtgaattacctctacgacctctcggcgatcgagaagaaccacgagacctacgtcaatctc
ggcacggtcgcgacctcctcggcggtcagccgcgagttgcgctccaacctgccgccgccg
cgggcggtggtgctggccgaggcaggttga

DBGET integrated database retrieval system