KEGG   Methylobacterium populi: Mpop_5359Help
Entry
Mpop_5359         CDS       T00760                                 

Gene name
bchH
Definition
magnesium chelatase subunit H
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
mpo  Methylobacterium populi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mpo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5728690..5732415)
Genome map
AA seq 1241 aa AA seqDB search
MPRRISAARPPFRVVIVTLDNHLASAVERARLRLATEMPGLSLSFHAAAEWETDGAALRA
CEAEIARADIVVSAMLFLDEHVRAILPALLARRASCDAMIGCLSAAEIVRTTRLNRLDMS
GAKRSALDFLKRLRGKPGAEGNAARQMALVRKLPKILRFIPGSAQDVRAYFLTLQYWLAG
SDENVASLVRFLVQRYAAGPRAAWREIAAAPPPQHYPETGLYHPRLPGRVGETLSAVPIV
PGARGRVGLLLMRSYVLAGNTAHYDGVIAALEARGLSVVPAFAAGLDNRPAVDAFFTENG
RPAIDALVSLTGFSLVGGPAYNDAAAAEATLTRLDVPYLAAHALEFQTIEQWEAGARGLS
PVEATMMVAIPELDGATAPTVFGGRSSASGSGNARDMRVHPERAERLATRIERLVSLRRK
PKHERHLAVVLFNFPPNAGATGSAAFLSVYASLLNTLRGLAADGYTVEIPASVDALRDRI
LGGNAGRYGTPANVHARVSAEDHVRRETYLPEIEAQWGPAPGRHQSNGADILVLGAQFGN
VFVGVQPAFGYEGDPMRLLFEQGFAPTHAFSAFYRWLREDFSADAVLHFGTHGALEFMPG
KQTGLSAACWPERLIGAVPNIYLYAANNPSEGTLAKRRSAATLVSYLTPSLAAAGLYRGL
SDLKVSVERWRALEPEAAAERTALAAIIQAQGAAVDLVAEPAWDGNPGPHVAALAAALTE
LEQTLIPHGLHVVGEGMVREERVDLLLALADASHGLKPAPAGIDRLVEGASLGEALTAAG
LPADETHRSAFADLARIDRELARDSELSALMRALDGRFVAPVAGGDLLRNPGILPTGRNL
HGFDPYRLPSAFAIADGAKQVARVLERHLSEGRALPESVALVLWGTDNLKSEGGPIAQAL
ALIGAVPRFDGYGRLAGAELIPLERLGRPRIDAVVTLSGIFRDLLPLQTKLLAEASFLAA
SADEPTDDNFVRKHALAIQAEQGCDFETAALRVFSNAEGAYGANVNHLVESGRWDDEDEL
CETFSRRKSFAYGRTGRPAPQRDLMKAVLARVDLAYQNLDSVELGVTSVDHYFDGLGGMG
RAVARAKGASVPIYISDQTRGEGRVRSLDEQVALETRTRMLNPKWYEGLLGHGYEGVRQI
EATLTNTVGWSATAGAVQPWIYERITETFVLDAAMRDRMATLNPTACAKVASRLIEAHRR
GFWTPDRAMRDALDRAEEELEDRLEGVTPGALPGITAGVAA
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggcgcatttcggccgctaggcccccgttccgcgtcgtcatcgtcacgctcgac
aatcacttggcgagcgcggtggaacgggcgcggctgcggctggccacggagatgccgggc
ctgtcgctgagcttccacgcggccgccgagtgggagaccgacggggcggcgctccgggcc
tgcgaggcggagatcgcgcgcgccgacatcgtcgtctcggcgatgctgttcctcgacgag
cacgtgcgggcgatcctgccggcgctgctcgcccggcgcgcgtcctgcgatgcgatgatc
ggctgcctttcggccgcggaaatcgtgcgcacgacgcggctcaaccgcctcgacatgagc
ggggccaagcgctcggccctcgacttcctgaagcggctgcgcggcaagccgggcgcggag
ggcaatgccgcgcggcaaatggcattggtgcgcaagctgccgaagatcctgcgcttcatc
cccggctcggcgcaggacgtgcgggcctactttctcaccctgcaatactggcttgcgggc
tcggacgagaacgtggcgagcctcgtgcgcttcctcgtgcagcgctacgccgccggtccg
cgcgcggcatggcgggagatcgccgccgcgccgccgccgcagcattaccccgagacaggc
ctgtaccatccgcgcctgccgggccgtgtcggcgagaccctgtccgccgtgcccatcgtg
cccggcgcccgcggccgcgtcggcctgctgctgatgcgctcctacgtgctcgccggcaat
acggcgcattacgacggcgtcatcgccgccctcgaagcgcggggcctgtcggtggtgccg
gccttcgccgccgggctcgacaaccgcccggcggtggacgccttcttcaccgagaacggc
cgcccggcgatcgacgcactggtctcgctcaccggcttctcgctggtcggcggcccggcc
tacaacgacgcggcggcggccgaggcgacgctcacgcggctcgacgtgccctatctcgcg
gcccacgcgctcgaattccagacgatcgagcaatgggaggcgggtgcccgcggcctctct
ccggttgaggcgaccatgatggtcgcgatccccgaactcgacggcgccaccgcgccgacc
gtgttcggtggccgctcctcggcgtccggcagcggcaatgctcgcgacatgcgcgtgcat
cccgagcgggccgagcggcttgccacccggatcgagcgcctcgtctctctgcggcgcaag
ccgaagcacgagcggcaccttgccgtcgtgctgttcaacttcccgcccaatgccggcgcc
accggctcggccgctttcctctcggtctacgcctcgctgctcaacaccctgcgcgggctc
gcagccgacggttacacggtcgagattcccgccagcgtcgatgcactgcgcgacagaatt
ctcggcggcaacgctgggcgctacggcacgccggccaacgtccatgcccgcgtgtccgcc
gaggatcacgtccgccgcgagacgtacctgccggagatcgaggcgcagtgggggccggca
ccgggccgccaccagagcaacggcgccgacatcctcgtgctcggcgcgcagttcggcaac
gtcttcgtcggggtgcagcccgccttcggctacgagggcgacccgatgcggttgctgttc
gagcagggtttcgcaccgacccacgccttcagcgccttctaccgctggctgcgcgaggat
ttctccgccgacgcggtgctgcatttcggcacccacggcgcactcgaattcatgcccggc
aagcagaccgggctctcggcggcctgctggcccgagcgtctgatcggcgcggtgcccaac
atctacctctatgccgccaacaacccgtcggagggcacgctcgccaagcgccgctccgcc
gcgacgctggtgagctatctcaccccgagcctcgccgcggccggcctctaccgcggcctg
agcgatctcaaggtctcggtcgagcgctggcgcgccctggaaccggaggcggcggccgag
cggacggcgctcgccgcgatcatccaggcgcagggcgcggcggtcgatctcgtcgccgag
ccggcctgggacggcaatccgggtccgcatgtggccgcgctcgctgccgcgctcacggaa
ctcgaacagacgctgatcccgcacggtctccacgtcgtcggcgaggggatggtgcgcgag
gaacgggtcgatctcctgctcgccctggcggacgcctcgcacgggctcaagcccgccccc
gccgggatcgacagattggtcgaaggcgcgagcctcggggaagcgctcaccgccgcgggg
ctgcccgccgacgaaacgcaccgaagcgccttcgccgacctcgcacggatcgaccgcgaa
ctcgcccgcgacagcgagctttccgcgctgatgcgggcgctggacgggcgcttcgtggcg
ccggtggcgggcggcgaccttctgcgcaatcccggtatcctgccgacggggcgcaacctg
cacggcttcgacccctatcgcctgccctccgccttcgcgatcgccgacggcgccaagcag
gtggcccgggtgctggagcgccacctctctgaggggcgggcgctgccggagagcgtcgcc
ctcgtcctgtggggcacagacaatctgaagagcgagggcggtcccatcgcccaggcgctg
gcactgatcggcgcggtgccccgcttcgacggttacggccggctcgccggagccgagctg
atcccgctcgaacgcctcggccgcccgcgcatcgatgcggtggtgacgctctcgggcatc
tttcgcgacctgctcccgctccagaccaagctgctggcggaagcgagctttctcgccgcc
agcgcggacgagccgaccgacgacaacttcgtgcgcaagcatgccctggcgatccaggcc
gagcagggctgcgatttcgagacggcggccctgcgcgtcttctccaacgccgagggcgcc
tacggcgccaacgtcaaccacctggtcgaatccggccgctgggacgacgaggacgaactc
tgcgagacgttttcgcggcgcaagagcttcgcctacggccgcaccggccgcccggcgccg
cagcgcgacctgatgaaggcggttctggcccgggtcgatctcgcctaccagaacctcgac
tcggtcgaactcggcgttacgagcgtcgatcactacttcgacgggctcggcggcatgggc
cgggcggtggcccgcgccaagggcgcgagcgtgccgatctacatcagcgaccagacccgc
ggggagggccgcgtgcgctcgctcgacgagcaggtagcgctggaaacccgcacccgcatg
ctcaacccgaaatggtacgagggcctgctcggccacggctacgagggcgtgcgccagatc
gaggcgacgctgaccaacaccgtcggctggtcggccaccgccggtgcggtgcagccctgg
atctacgaacgcatcaccgagactttcgtgctcgatgcggccatgcgcgaccgcatggcg
acgctcaaccccaccgcctgcgccaaggtcgcgagccgcctgatcgaggctcaccgccgc
ggcttctggacccccgaccgggcgatgcgcgacgcgctcgaccgtgccgaggaggagctg
gaggaccgcctcgaaggcgtcacgcccggagccttgcccggcatcaccgcaggagtcgcg
gcatga

DBGET integrated database retrieval system