KEGG   Micromonas pusilla: MICPUCDRAFT_13654Help
Entry
MICPUCDRAFT_13654 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mpp  Micromonas pusilla
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MICPUCDRAFT_13654
Enzymes [BR:mpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MICPUCDRAFT_13654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 208 aa AA seqDB search
MKYTDFAQGLNISKNTGEIHLITGPMFSGKTTELLERVSQEEALGLVVSLVKSFEDFRYS
CDHIVTHDGILRTCFSVAKLNEIRSTLGDAEWRRVDIFAIDEAQFLPDLPRFCAAADSEK
KKIIFAGLEGDFRREQFGKLLDLLPLCDSIFKLSAKCCSCNIRPATFTSRISPENNTAQQ
CIGGSDTYQTVCRSCFVRSKLFALYLVK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatacagatttcgcacaaggtctaaatatttcgaagaacactggggagatccac
ctcatcacagggcccatgttttctggaaagacaacagagcttcttgagagagtctcccaa
gaagaggcgcttggactcgttgtttcacttgttaagtcttttgaggattttagatattcg
tgcgatcatattgtgactcatgatgggattctgcgtacatgtttctcagttgcaaaactt
aatgaaattcgcagcactcttggcgatgctgagtggcgtagagtcgacattttcgctata
gacgaagcacaattccttccagatcttccccggttctgtgcagccgcagactcagagaaa
aagaaaattatttttgctggtcttgagggagactttcgtcgtgaacagtttggcaaactc
ctcgatctactacccttgtgtgactctatctttaaactctccgcaaaatgttgtagctgc
aatataagacccgcaacatttacctcacgcatatctcctgaaaacaacacagcacagcaa
tgtatcggtggctcggatacatatcagaccgtttgtaggtcgtgcttcgtgaggtcgaaa
ctctttgctttgtacctagtcaaataa

DBGET integrated database retrieval system