KEGG   Micromonas pusilla: MICPUCDRAFT_14294Help
Entry
MICPUCDRAFT_14294 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     MICPUCDRAFT_14294
Protein kinases [BR:mpp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   MICPUCDRAFT_14294
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 380 aa AA seqDB search
MGEEIDRHVLRKYEIQQKLGKGAYGIVWKTVDKKTRDTVALKKIFDAFQNSTDAQRTFRE
IMFLQEVNNHDNIIRLLNVLKAENDRDIYLIFEYMETDLHAVIRANILEDVHKQYIMYQL
FKALKFMHSAELLHRDIKPSNLLLNSECQVKVADFGLARSMALMNKDLADRPVLTDYVAT
RWYRAPEILLGSTKYTFGVDMWSCGCILGELFRGQPVFPGTSTMNQLDRIIQLTGKPTEE
DLLAIQSPFAESMLESLPCTSSNTTRELIPNTSEHAFDLLHKLLDINPDKRIIADAALRH
PYLSQFHNPADEPSCNHVISIPINDNTKYTIQEYREILYSEVVKRKKVPLDLVIAYFFSN
AIICQELRRRLRQRELARPN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaaattgataggcacgtcttgaggaaatacgaaatacaacagaaacttggg
aagggggcgtatggtatagtgtggaaaacggttgacaagaaaacacgagacacggttgca
ttgaagaagattttcgacgcttttcaaaactcaacagatgcacagcgaacatttagagag
atcatgtttttgcaagaggtgaacaaccatgataatattatacggctactgaatgtgctg
aaggcagaaaatgatagagatatatatcttatttttgaatacatggaaactgatttgcac
gcagtcatcagagccaatatccttgaggacgtccacaagcagtacatcatgtatcagtta
tttaaagctttgaagttcatgcattctgctgagcttctgcaccgggacatcaagcccagc
aaccttctgcttaacagtgagtgccaagtcaaggttgcagacttcggtcttgcacgctcc
atggctctcatgaataaggatttagctgacaggccagtattgacagattatgttgcaacg
cgctggtatcgtgctccagaaattctccttggttctacgaaatatacttttggtgttgat
atgtggtcctgtggttgcattctgggtgaactctttcgagggcagcctgttttccccgga
acgtcaaccatgaatcaactcgaccgcattatacagttaaccggaaagccaacggaggag
gatttgcttgcaattcaatctcccttcgctgaatctatgctagagtcattgccatgcaca
agttcaaatacaacacgtgagctgattccgaacacaagcgagcatgcatttgatttgctg
cacaagctcttggacataaaccctgataagaggataatagctgatgcagcattgcgtcac
ccatacctatcgcagttccacaatcctgcggacgaaccatcatgcaaccacgtgatatct
attcctatcaatgataatacaaagtatactatccaggagtacagagaaattttatactcg
gaagttgtaaaacgcaaaaaggtcccgcttgatttagtcattgcatactttttctcaaac
gctatcatttgtcaggagttaagacgacgcttgcgacagcgggagttggctcggcctaat
taa

DBGET integrated database retrieval system