KEGG   Micromonas pusilla: MICPUCDRAFT_14294Help
Entry
MICPUCDRAFT_14294 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
mpp  Micromonas pusilla
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 380 aa AA seqDB search
MGEEIDRHVLRKYEIQQKLGKGAYGIVWKTVDKKTRDTVALKKIFDAFQNSTDAQRTFRE
IMFLQEVNNHDNIIRLLNVLKAENDRDIYLIFEYMETDLHAVIRANILEDVHKQYIMYQL
FKALKFMHSAELLHRDIKPSNLLLNSECQVKVADFGLARSMALMNKDLADRPVLTDYVAT
RWYRAPEILLGSTKYTFGVDMWSCGCILGELFRGQPVFPGTSTMNQLDRIIQLTGKPTEE
DLLAIQSPFAESMLESLPCTSSNTTRELIPNTSEHAFDLLHKLLDINPDKRIIADAALRH
PYLSQFHNPADEPSCNHVISIPINDNTKYTIQEYREILYSEVVKRKKVPLDLVIAYFFSN
AIICQELRRRLRQRELARPN
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaaattgataggcacgtcttgaggaaatacgaaatacaacagaaacttggg
aagggggcgtatggtatagtgtggaaaacggttgacaagaaaacacgagacacggttgca
ttgaagaagattttcgacgcttttcaaaactcaacagatgcacagcgaacatttagagag
atcatgtttttgcaagaggtgaacaaccatgataatattatacggctactgaatgtgctg
aaggcagaaaatgatagagatatatatcttatttttgaatacatggaaactgatttgcac
gcagtcatcagagccaatatccttgaggacgtccacaagcagtacatcatgtatcagtta
tttaaagctttgaagttcatgcattctgctgagcttctgcaccgggacatcaagcccagc
aaccttctgcttaacagtgagtgccaagtcaaggttgcagacttcggtcttgcacgctcc
atggctctcatgaataaggatttagctgacaggccagtattgacagattatgttgcaacg
cgctggtatcgtgctccagaaattctccttggttctacgaaatatacttttggtgttgat
atgtggtcctgtggttgcattctgggtgaactctttcgagggcagcctgttttccccgga
acgtcaaccatgaatcaactcgaccgcattatacagttaaccggaaagccaacggaggag
gatttgcttgcaattcaatctcccttcgctgaatctatgctagagtcattgccatgcaca
agttcaaatacaacacgtgagctgattccgaacacaagcgagcatgcatttgatttgctg
cacaagctcttggacataaaccctgataagaggataatagctgatgcagcattgcgtcac
ccatacctatcgcagttccacaatcctgcggacgaaccatcatgcaaccacgtgatatct
attcctatcaatgataatacaaagtatactatccaggagtacagagaaattttatactcg
gaagttgtaaaacgcaaaaaggtcccgcttgatttagtcattgcatactttttctcaaac
gctatcatttgtcaggagttaagacgacgcttgcgacagcgggagttggctcggcctaat
taa

DBGET integrated database retrieval system