KEGG   Micromonas pusilla: MICPUCDRAFT_19221Help
Entry
MICPUCDRAFT_19221 CDS       T02696                                 

Gene name
SBEI
Definition
(RefSeq) glycoside hydrolase family 13 protein
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mpp  Micromonas pusilla
Pathway
mpp00500  Starch and sucrose metabolism
mpp01100  Metabolic pathways
mpp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUCDRAFT_19221 (SBEI)
Enzymes [BR:mpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MICPUCDRAFT_19221 (SBEI)
Exosome [BR:mpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MICPUCDRAFT_19221 (SBEI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C CBM_48 Alpha-amylase Glyco_hydro_66
Motif
Other DBs
NCBI-GeneID: 9685915
NCBI-ProteinID: XP_003060477
JGI: 19221
UniProt: C1MXZ5
AA seq 887 aa AA seqDB search
MRASKKGNSTNKNSPLSRESHRTSKRSGCAVAAAAYTEDGMGCAGVDDKLYEHEGHLKYR
WQKFVETKEAIVSAEGSLEDFSKGHKKFGFNRNSNGEIVYREWAPAAAEAWLIGDFNGWS
GDATPLTKDDFGVWTTTLPPDGIQHGSRVKIRMRTGDGGFTDRIPAWIKYSTAEAGVMGA
NYDGIFWDPPPGQEYVRKNPRPPRPAASRIYEAHVGMSGASHTLVNTYRDFADEILPRIA
DDGYNTVQLMAIMEHAYYGSFGYHVTSPFAVSSRCGTPEDLKYLVDKAHGFGIRVLLDVI
HCHASCNTEDGIAGFDIGQQTADSYFHTGDEGYHWLWDSRLYNYGNWEVQRYLLSNLRYW
VDEYGFDGFRFDGVTSMLYNHHGLQMDFTGDYNEYFGLDTNVSAVVYLMLANDMLHGVYP
GIEVIAEDVSGMPTLCRPVTEGGIGFDARLGMAIPDLWVRLLKASREGRLRDEDWSMHEI
IASLCNRRYTEKVIGYAESHDQSIVGDKTNAFWLMDKEMYEGMSTFDEASDEVSRGMALH
KMIRLLTIAIGGEGYLNFMGNEFGHPEWVDFPREGNDWSHEHCRRRWDLADTEYLRYSEL
GQFDKAMMALDQQYKFLGDAHQFVSSADEERKVIVAERGPLLFVFNFHPTESYEGLEVGV
GMGGKYRIVLDTDAWSFGGQGRVGHDFDHFSNPGGPVTFVGPYEQEPRPASLKVLSPCRC
AQVYFKIDEDGAAANYDTAASVHDFGRGVHLTSDAPRAAPVEERYGDERLYQDTVSSEYD
SDWMKAEQARQSQSRSAAAPSGGGGGGGGGGGGGSSEYDSDWMKAQMAAAAANGGSELVR
PTPPTPPPAMGGGGGGGGRGGASRPERVTRGKDGVIYDPDQFDPDNN
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgtcgaagaagggaaactccacgaataagaacagcccgctgtcgcgcgaatct
catcgaacctcgaaacgatccgggtgcgcggtcgccgccgcggcgtacaccgaagacggc
atgggctgcgcgggcgtggacgacaagctctacgagcacgaggggcacctgaagtaccgc
tggcaaaagttcgtggagacgaaggaggcgatcgtgagcgcggagggctccctcgaggac
ttctccaagggccacaaaaagtttggcttcaaccgcaactcgaacggcgagatcgtctac
cgcgagtgggcccccgcggccgcggaggcgtggctcatcggcgacttcaacggctggagc
ggcgacgcgaccccgctgacgaaggacgacttcggcgtgtggaccacgacgctccctccc
gacggcatccaacacggctcgcgcgtgaagatccgcatgcgcaccggcgacggaggcttc
accgaccgcatcccggcgtggatcaagtacagcacggccgaggcgggcgtcatgggcgcc
aactacgacggcatcttctgggacccgccgccggggcaggagtacgtgcggaagaacccg
cgcccgccgcggccggcggcgagccgcatctacgaggcgcacgtgggcatgtcaggcgcg
tcccatacactggtgaacacgtaccgggatttcgcggacgagatcctcccgcggatcgcg
gacgacgggtacaacaccgtgcagctcatggcgatcatggagcacgcgtactacggctcg
ttcgggtaccacgtcacgagccccttcgcggtgtcgtcgcggtgcggcacgcccgaggat
ctcaagtatctcgtcgacaaggcgcacgggttcgggattcgcgtgctgctcgacgtgatt
cactgccacgcgtcgtgtaacaccgaggacggcatcgcggggttcgacatcgggcagcag
accgcggactcgtacttccacaccggcgacgagggataccactggctgtgggattcgcgg
ctgtacaattacggcaactgggaagtccagcggtacctcctgtcgaaccttcgatactgg
gtcgacgagtacggcttcgacggcttcaggttcgacggcgtgacgtccatgctgtacaac
caccacggcctccagatggacttcaccggggactacaacgagtatttcggcctcgacacc
aacgtctccgccgtcgtctatctgatgctcgcgaacgacatgctccacggcgtgtacccc
gggatcgaagtcatcgcggaggacgtctccgggatgccgacgctgtgccgcccggtgacc
gagggcgggatcgggttcgacgcgcgcctcgggatggcgatcccggatctgtgggtccgg
ctcctgaaggcgtccagggaggggcgcctgcgcgacgaagactggagcatgcacgagatc
atcgcttcgctgtgcaaccgccggtacacggaaaaggtcatcgggtacgcggagtcgcac
gaccagtcgatcgtgggcgataagacgaacgcgttctggctcatggacaaggagatgtac
gaggggatgagcacgttcgacgaagcctcggacgaggtgtcgcgagggatggcgcttcac
aagatgatccgcctgctcaccatcgccatcggcggcgagggctatctcaactttatgggg
aacgagttcgggcaccccgagtgggtcgacttcccgcgagaggggaacgactggtcgcac
gagcactgccgccgacgctgggacctcgcggacacggagtacctgcgatacagcgagctc
gggcagtttgacaaggcgatgatggcgctcgatcagcagtacaaattcttgggcgacgcg
caccagttcgtctcgagcgcggatgaagagcggaaagtgatcgtcgccgagcgcgggcct
ctcctcttcgtcttcaacttccaccccacggagagctacgaaggcctcgaagtcggcgtc
ggcatgggcgggaagtaccggatcgtcctcgacacggacgcgtggtccttcggaggccaa
ggacgcgtcgggcacgactttgaccacttctccaacccgggcggccccgtcacgttcgtc
gggccgtacgagcaagagcccaggccggcgtctctcaaagttctctccccgtgccgctgc
gcgcaggtgtactttaaaatcgacgaggacggcgccgccgccaactacgacaccgccgcg
agcgtgcacgatttcggcagaggcgtgcacttgacgtcggacgcgccgagagccgcgccc
gtggaggaacggtacggcgacgagcgcctgtaccaggatacggtgagcagcgagtacgac
tcggactggatgaaggcggagcaagcgcggcagtcgcagtcgcgatccgccgcggcgccg
tcgggcggcggcggcggcggcggcggcggcggcggcggagggagcagcgagtacgactcg
gattggatgaaggcgcagatggcggcggcggcggcgaacggcgggagcgagctcgtgcgg
ccgacgccgccgacgccgccgccggcgatgggcggcggcggcggcggcggcggacggggc
ggcgcgagccggccggagcgcgtcacgcgagggaaggatggcgtcatctacgacccggac
cagttcgacccggacaacaactga

DBGET integrated database retrieval system