KEGG   Micromonas pusilla: MICPUCDRAFT_19221Help
Entry
MICPUCDRAFT_19221 CDS       T02696                                 

Gene name
SBEI
Definition
glycoside hydrolase family 13 protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mpp  Micromonas pusilla
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mpp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 887 aa AA seqDB search
MRASKKGNSTNKNSPLSRESHRTSKRSGCAVAAAAYTEDGMGCAGVDDKLYEHEGHLKYR
WQKFVETKEAIVSAEGSLEDFSKGHKKFGFNRNSNGEIVYREWAPAAAEAWLIGDFNGWS
GDATPLTKDDFGVWTTTLPPDGIQHGSRVKIRMRTGDGGFTDRIPAWIKYSTAEAGVMGA
NYDGIFWDPPPGQEYVRKNPRPPRPAASRIYEAHVGMSGASHTLVNTYRDFADEILPRIA
DDGYNTVQLMAIMEHAYYGSFGYHVTSPFAVSSRCGTPEDLKYLVDKAHGFGIRVLLDVI
HCHASCNTEDGIAGFDIGQQTADSYFHTGDEGYHWLWDSRLYNYGNWEVQRYLLSNLRYW
VDEYGFDGFRFDGVTSMLYNHHGLQMDFTGDYNEYFGLDTNVSAVVYLMLANDMLHGVYP
GIEVIAEDVSGMPTLCRPVTEGGIGFDARLGMAIPDLWVRLLKASREGRLRDEDWSMHEI
IASLCNRRYTEKVIGYAESHDQSIVGDKTNAFWLMDKEMYEGMSTFDEASDEVSRGMALH
KMIRLLTIAIGGEGYLNFMGNEFGHPEWVDFPREGNDWSHEHCRRRWDLADTEYLRYSEL
GQFDKAMMALDQQYKFLGDAHQFVSSADEERKVIVAERGPLLFVFNFHPTESYEGLEVGV
GMGGKYRIVLDTDAWSFGGQGRVGHDFDHFSNPGGPVTFVGPYEQEPRPASLKVLSPCRC
AQVYFKIDEDGAAANYDTAASVHDFGRGVHLTSDAPRAAPVEERYGDERLYQDTVSSEYD
SDWMKAEQARQSQSRSAAAPSGGGGGGGGGGGGGSSEYDSDWMKAQMAAAAANGGSELVR
PTPPTPPPAMGGGGGGGGRGGASRPERVTRGKDGVIYDPDQFDPDNN
NT seq 2664 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgtcgaagaagggaaactccacgaataagaacagcccgctgtcgcgcgaatct
catcgaacctcgaaacgatccgggtgcgcggtcgccgccgcggcgtacaccgaagacggc
atgggctgcgcgggcgtggacgacaagctctacgagcacgaggggcacctgaagtaccgc
tggcaaaagttcgtggagacgaaggaggcgatcgtgagcgcggagggctccctcgaggac
ttctccaagggccacaaaaagtttggcttcaaccgcaactcgaacggcgagatcgtctac
cgcgagtgggcccccgcggccgcggaggcgtggctcatcggcgacttcaacggctggagc
ggcgacgcgaccccgctgacgaaggacgacttcggcgtgtggaccacgacgctccctccc
gacggcatccaacacggctcgcgcgtgaagatccgcatgcgcaccggcgacggaggcttc
accgaccgcatcccggcgtggatcaagtacagcacggccgaggcgggcgtcatgggcgcc
aactacgacggcatcttctgggacccgccgccggggcaggagtacgtgcggaagaacccg
cgcccgccgcggccggcggcgagccgcatctacgaggcgcacgtgggcatgtcaggcgcg
tcccatacactggtgaacacgtaccgggatttcgcggacgagatcctcccgcggatcgcg
gacgacgggtacaacaccgtgcagctcatggcgatcatggagcacgcgtactacggctcg
ttcgggtaccacgtcacgagccccttcgcggtgtcgtcgcggtgcggcacgcccgaggat
ctcaagtatctcgtcgacaaggcgcacgggttcgggattcgcgtgctgctcgacgtgatt
cactgccacgcgtcgtgtaacaccgaggacggcatcgcggggttcgacatcgggcagcag
accgcggactcgtacttccacaccggcgacgagggataccactggctgtgggattcgcgg
ctgtacaattacggcaactgggaagtccagcggtacctcctgtcgaaccttcgatactgg
gtcgacgagtacggcttcgacggcttcaggttcgacggcgtgacgtccatgctgtacaac
caccacggcctccagatggacttcaccggggactacaacgagtatttcggcctcgacacc
aacgtctccgccgtcgtctatctgatgctcgcgaacgacatgctccacggcgtgtacccc
gggatcgaagtcatcgcggaggacgtctccgggatgccgacgctgtgccgcccggtgacc
gagggcgggatcgggttcgacgcgcgcctcgggatggcgatcccggatctgtgggtccgg
ctcctgaaggcgtccagggaggggcgcctgcgcgacgaagactggagcatgcacgagatc
atcgcttcgctgtgcaaccgccggtacacggaaaaggtcatcgggtacgcggagtcgcac
gaccagtcgatcgtgggcgataagacgaacgcgttctggctcatggacaaggagatgtac
gaggggatgagcacgttcgacgaagcctcggacgaggtgtcgcgagggatggcgcttcac
aagatgatccgcctgctcaccatcgccatcggcggcgagggctatctcaactttatgggg
aacgagttcgggcaccccgagtgggtcgacttcccgcgagaggggaacgactggtcgcac
gagcactgccgccgacgctgggacctcgcggacacggagtacctgcgatacagcgagctc
gggcagtttgacaaggcgatgatggcgctcgatcagcagtacaaattcttgggcgacgcg
caccagttcgtctcgagcgcggatgaagagcggaaagtgatcgtcgccgagcgcgggcct
ctcctcttcgtcttcaacttccaccccacggagagctacgaaggcctcgaagtcggcgtc
ggcatgggcgggaagtaccggatcgtcctcgacacggacgcgtggtccttcggaggccaa
ggacgcgtcgggcacgactttgaccacttctccaacccgggcggccccgtcacgttcgtc
gggccgtacgagcaagagcccaggccggcgtctctcaaagttctctccccgtgccgctgc
gcgcaggtgtactttaaaatcgacgaggacggcgccgccgccaactacgacaccgccgcg
agcgtgcacgatttcggcagaggcgtgcacttgacgtcggacgcgccgagagccgcgccc
gtggaggaacggtacggcgacgagcgcctgtaccaggatacggtgagcagcgagtacgac
tcggactggatgaaggcggagcaagcgcggcagtcgcagtcgcgatccgccgcggcgccg
tcgggcggcggcggcggcggcggcggcggcggcggcggagggagcagcgagtacgactcg
gattggatgaaggcgcagatggcggcggcggcggcgaacggcgggagcgagctcgtgcgg
ccgacgccgccgacgccgccgccggcgatgggcggcggcggcggcggcggcggacggggc
ggcgcgagccggccggagcgcgtcacgcgagggaaggatggcgtcatctacgacccggac
cagttcgacccggacaacaactga

DBGET integrated database retrieval system