KEGG   Micromonas pusilla: MICPUCDRAFT_19691Help
Entry
MICPUCDRAFT_19691 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mpp  Micromonas pusilla
Pathway
mpp00020  Citrate cycle (TCA cycle)
mpp00310  Lysine degradation
mpp00380  Tryptophan metabolism
mpp01100  Metabolic pathways
mpp01110  Biosynthesis of secondary metabolites
mpp01200  Carbon metabolism
Module
mpp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MICPUCDRAFT_19691
  Amino acid metabolism
   00310 Lysine degradation
    MICPUCDRAFT_19691
   00380 Tryptophan metabolism
    MICPUCDRAFT_19691
Enzymes [BR:mpp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MICPUCDRAFT_19691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh OxoGdeHyase_C Transket_pyr Creatininase
Motif
Other DBs
NCBI-GeneID: 9686552
NCBI-ProteinID: XP_003060855
JGI: 19691
UniProt: C1MYW8
AA seq 930 aa AA seqDB search
LQVVRAIRNRGHFAARLDPLGRSLGPLREGYEAMETSYLGLHDVDPDRKFYFGNEWWTLN
EVLTRLQTIYCGTLTAEFHHIASARKKAWLQATLEGETEGKGHWVSARDRREVLRRLISA
DALERLLARSFPSAKRFGVEGAETLIPGLQAVVDAAATHGVESIVMGVAHRGRLNILNNV
FRKPVGAICAEMRSEGTSSFNVGDVRYHLGTRTVVRVPERPDEEAGGGEMELSMAPNPSH
LEAVNAVVTGMVRSKQMRRDARRGGRSRTAQGAVMGLIIHGDAAFCGLGANAEVMQLQDL
PDYTTGGTVHIVVNNQIGFTTVPRRARSSPHPSDVAKGYGAPIFHVNGDDPEAVVRACRL
AVAYRAECRADVVVNLVCYRRYGHNEQDDPSITLPLRSKAIENHPRVVDVFARKLVAAGD
IGEEEVERWRRETDEKFRAEHAGAAAHVESPEDWVVSSWKRPVDPVNPRARVTGVPLSLL
RASYHKNSLFPRDFEPHPHVRKLLSQRKAMVDEQTGVDWGTAELLAFGTLLTHDGEGEIE
NNGSSEGVTDTKGDPKPHCHVRLSGQDVERGTFNHRHSVLYCARSSRGHVPLNNLGLGPQ
DAFMVSNSPLSEHAILGFEYGFSVDAGPSALVLWEAQFGDFANNAQCVVDQFITTGEAKW
GQRSGLVLLLPHGYDGQGPDHSNARPERWLAAANDDADTLPGRSPKDYFHALRRQALASH
LKPMVVFTPKFLLHHRPCQSSLSDFGPGTRFHAVIGDGDDGDNTKNNASSDGVTKENHST
RDDRDVRRVVVCTGKMFYALQQARKRRGLEKEIALVRVEQLAPFPHGALASRLGKYPDAE
IVWCQEEPKNMGWWPFVQPRINTAVRDLLLGGGGGRTARYVGRPSTASPATGSQSIHALE
MKSIVQEALRGVTEFPTKYAGPYGGGGGGG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
ctccaggtggtgcgcgccatccgcaaccgcgggcacttcgccgcgaggctcgacccgctc
ggtcggtcgctcgggccgctccgtgagggctacgaggccatggagacgtcctacttgggc
ctccacgacgtcgaccccgatcgaaagttttacttcgggaacgagtggtggacgctgaac
gaagtcctgacgcggctgcagacgatatactgcgggacgctgaccgcggagtttcatcac
atcgcgagcgcgaggaagaaagcgtggctgcaggcgacgctggagggcgagaccgagggg
aaagggcactgggtgagcgcgcgcgaccgaagagaggtgctgcggcggctcatctccgcg
gacgcgctcgagcggctcctcgcgcggtcgttcccgtccgcgaagcggttcggcgtggag
ggcgcggagacgctgattcccgggttgcaggctgtcgtcgacgcggcggcgacgcacggc
gtggagagcatcgtgatgggcgtggcgcatcgagggcgtctgaatattttgaacaacgtg
tttcgaaagcccgtcggcgcgatctgcgcggagatgcgcagcgaagggacgtcgtcgttc
aacgtcggggacgtgcggtatcacttggggacgcggacggtcgtgcgcgtccccgagaga
cccgacgaagaggccggcggcggagagatggaattgtccatggccccgaacccctcgcac
ctcgaggcggtcaacgccgtcgtgaccgggatggtccgctcgaaacagatgagacgcgac
gcgcgcagaggcggccgctctcgaaccgcgcagggcgcggtcatgggcctcatcatccac
ggcgacgcggcgttttgcggcctcggcgccaacgcagaggtgatgcagcttcaagacttg
ccggactacaccaccggcggcaccgtgcacatcgtcgtgaacaaccagatcggcttcacg
accgtcccgcgtcgcgcgcggtcgtcgccgcacccgtcggacgtcgcgaaagggtacggc
gcgccgatattccacgtcaacggggacgatcccgaggctgtcgtccgcgcgtgtcgcctc
gccgtcgcgtacagggcggagtgccgcgcggacgtcgtcgtcaacttggtgtgctaccgc
cggtacggccacaacgagcaggacgatccgtccatcacgctgccgctgcggtcgaaggcg
atcgagaatcacccgagggtggtggacgtcttcgcgagaaagctcgtggccgcgggcgac
atcggggaggaggaggtggagcggtggaggcgagagacggatgagaaattccgcgccgag
cacgcgggcgcggcggcgcacgtcgagagccccgaggattgggtcgtgtcgtcgtggaag
cgaccggtcgacccggtcaacccgagggcgagggtgaccggcgtgccgttgtcgttgctt
cgcgccagctatcataagaacagtctgttcccgcgcgacttcgagccgcaccctcacgtg
cggaagcttctgtcgcagcgcaaggcgatggtcgacgagcaaacgggcgtggactggggc
accgcggagctcttagcgttcgggacgctgctaacgcacgacggcgagggcgagatcgaa
aataacggatcttctgaaggcgttaccgacacgaaaggggacccgaagccgcactgccac
gtgcgcctgagcggccaagacgtcgagcgagggacgttcaaccaccgccactccgtgctg
tactgtgcgcggtcgtcgcgagggcacgtcccgttaaacaacctcggcctcggcccgcaa
gacgcgttcatggtatcgaactcgcctctgagcgagcacgcgatcctggggttcgagtac
ggcttcagcgtcgacgcggggccgtccgcgctcgtgctgtgggaggcgcagttcggcgac
ttcgcgaacaacgcgcagtgcgtcgtggaccaattcataaccacgggcgaggcgaagtgg
ggccagcgaagcggcctcgtgcttctgcttccgcacgggtacgacggtcaaggtccagac
cacagcaacgcgcgcccggagcgatggctcgccgccgcgaacgacgacgcggacacgctg
ccggggcggtcgcccaaggactactttcacgcgcttcgccggcaagcgctcgcgtcgcat
ttgaagccgatggtggtgttcacgcccaagtttttgctgcatcaccgcccgtgtcagtcg
agcttgagcgatttcggcccggggacgcgattccacgccgtcatcggcgacggcgacgac
ggagacaacacgaagaataacgcctcgagtgatggcgttaccaaagaaaaccactccact
cgcgacgaccgcgacgtccgacgcgtcgtcgtctgcaccgggaagatgttctacgcgctg
cagcaagcgcgtaaacgacgcgggctcgagaaggaaatcgcgctcgtgcgcgtggaacag
ctggcgccgttccctcacggcgcgctcgcgtcgcgcctgggtaaataccccgacgcggag
atcgtgtggtgccaagaggagccgaagaacatggggtggtggccgttcgtgcagccgcgc
ataaacaccgcggtgcgggatcttctcctcggcggcggcggcgggcggacggcgcggtac
gtcgggcggccgtccacggcgtcgcccgcgacgggtagtcagtcgattcacgcgctggag
atgaagagcatcgtgcaggaggcgttgcggggggtcacggagtttccgacgaaatacgcg
ggaccgtacgggggcggcggcggcggcgggtga

DBGET integrated database retrieval system