KEGG   Micromonas pusilla: MICPUCDRAFT_19691Help
Entry
MICPUCDRAFT_19691 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mpp  Micromonas pusilla
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MICPUCDRAFT_19691
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MICPUCDRAFT_19691
  Amino acid metabolism
   00310 Lysine degradation
    MICPUCDRAFT_19691
   00380 Tryptophan metabolism
    MICPUCDRAFT_19691
Enzymes [BR:mpp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MICPUCDRAFT_19691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 930 aa AA seqDB search
LQVVRAIRNRGHFAARLDPLGRSLGPLREGYEAMETSYLGLHDVDPDRKFYFGNEWWTLN
EVLTRLQTIYCGTLTAEFHHIASARKKAWLQATLEGETEGKGHWVSARDRREVLRRLISA
DALERLLARSFPSAKRFGVEGAETLIPGLQAVVDAAATHGVESIVMGVAHRGRLNILNNV
FRKPVGAICAEMRSEGTSSFNVGDVRYHLGTRTVVRVPERPDEEAGGGEMELSMAPNPSH
LEAVNAVVTGMVRSKQMRRDARRGGRSRTAQGAVMGLIIHGDAAFCGLGANAEVMQLQDL
PDYTTGGTVHIVVNNQIGFTTVPRRARSSPHPSDVAKGYGAPIFHVNGDDPEAVVRACRL
AVAYRAECRADVVVNLVCYRRYGHNEQDDPSITLPLRSKAIENHPRVVDVFARKLVAAGD
IGEEEVERWRRETDEKFRAEHAGAAAHVESPEDWVVSSWKRPVDPVNPRARVTGVPLSLL
RASYHKNSLFPRDFEPHPHVRKLLSQRKAMVDEQTGVDWGTAELLAFGTLLTHDGEGEIE
NNGSSEGVTDTKGDPKPHCHVRLSGQDVERGTFNHRHSVLYCARSSRGHVPLNNLGLGPQ
DAFMVSNSPLSEHAILGFEYGFSVDAGPSALVLWEAQFGDFANNAQCVVDQFITTGEAKW
GQRSGLVLLLPHGYDGQGPDHSNARPERWLAAANDDADTLPGRSPKDYFHALRRQALASH
LKPMVVFTPKFLLHHRPCQSSLSDFGPGTRFHAVIGDGDDGDNTKNNASSDGVTKENHST
RDDRDVRRVVVCTGKMFYALQQARKRRGLEKEIALVRVEQLAPFPHGALASRLGKYPDAE
IVWCQEEPKNMGWWPFVQPRINTAVRDLLLGGGGGRTARYVGRPSTASPATGSQSIHALE
MKSIVQEALRGVTEFPTKYAGPYGGGGGGG
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
ctccaggtggtgcgcgccatccgcaaccgcgggcacttcgccgcgaggctcgacccgctc
ggtcggtcgctcgggccgctccgtgagggctacgaggccatggagacgtcctacttgggc
ctccacgacgtcgaccccgatcgaaagttttacttcgggaacgagtggtggacgctgaac
gaagtcctgacgcggctgcagacgatatactgcgggacgctgaccgcggagtttcatcac
atcgcgagcgcgaggaagaaagcgtggctgcaggcgacgctggagggcgagaccgagggg
aaagggcactgggtgagcgcgcgcgaccgaagagaggtgctgcggcggctcatctccgcg
gacgcgctcgagcggctcctcgcgcggtcgttcccgtccgcgaagcggttcggcgtggag
ggcgcggagacgctgattcccgggttgcaggctgtcgtcgacgcggcggcgacgcacggc
gtggagagcatcgtgatgggcgtggcgcatcgagggcgtctgaatattttgaacaacgtg
tttcgaaagcccgtcggcgcgatctgcgcggagatgcgcagcgaagggacgtcgtcgttc
aacgtcggggacgtgcggtatcacttggggacgcggacggtcgtgcgcgtccccgagaga
cccgacgaagaggccggcggcggagagatggaattgtccatggccccgaacccctcgcac
ctcgaggcggtcaacgccgtcgtgaccgggatggtccgctcgaaacagatgagacgcgac
gcgcgcagaggcggccgctctcgaaccgcgcagggcgcggtcatgggcctcatcatccac
ggcgacgcggcgttttgcggcctcggcgccaacgcagaggtgatgcagcttcaagacttg
ccggactacaccaccggcggcaccgtgcacatcgtcgtgaacaaccagatcggcttcacg
accgtcccgcgtcgcgcgcggtcgtcgccgcacccgtcggacgtcgcgaaagggtacggc
gcgccgatattccacgtcaacggggacgatcccgaggctgtcgtccgcgcgtgtcgcctc
gccgtcgcgtacagggcggagtgccgcgcggacgtcgtcgtcaacttggtgtgctaccgc
cggtacggccacaacgagcaggacgatccgtccatcacgctgccgctgcggtcgaaggcg
atcgagaatcacccgagggtggtggacgtcttcgcgagaaagctcgtggccgcgggcgac
atcggggaggaggaggtggagcggtggaggcgagagacggatgagaaattccgcgccgag
cacgcgggcgcggcggcgcacgtcgagagccccgaggattgggtcgtgtcgtcgtggaag
cgaccggtcgacccggtcaacccgagggcgagggtgaccggcgtgccgttgtcgttgctt
cgcgccagctatcataagaacagtctgttcccgcgcgacttcgagccgcaccctcacgtg
cggaagcttctgtcgcagcgcaaggcgatggtcgacgagcaaacgggcgtggactggggc
accgcggagctcttagcgttcgggacgctgctaacgcacgacggcgagggcgagatcgaa
aataacggatcttctgaaggcgttaccgacacgaaaggggacccgaagccgcactgccac
gtgcgcctgagcggccaagacgtcgagcgagggacgttcaaccaccgccactccgtgctg
tactgtgcgcggtcgtcgcgagggcacgtcccgttaaacaacctcggcctcggcccgcaa
gacgcgttcatggtatcgaactcgcctctgagcgagcacgcgatcctggggttcgagtac
ggcttcagcgtcgacgcggggccgtccgcgctcgtgctgtgggaggcgcagttcggcgac
ttcgcgaacaacgcgcagtgcgtcgtggaccaattcataaccacgggcgaggcgaagtgg
ggccagcgaagcggcctcgtgcttctgcttccgcacgggtacgacggtcaaggtccagac
cacagcaacgcgcgcccggagcgatggctcgccgccgcgaacgacgacgcggacacgctg
ccggggcggtcgcccaaggactactttcacgcgcttcgccggcaagcgctcgcgtcgcat
ttgaagccgatggtggtgttcacgcccaagtttttgctgcatcaccgcccgtgtcagtcg
agcttgagcgatttcggcccggggacgcgattccacgccgtcatcggcgacggcgacgac
ggagacaacacgaagaataacgcctcgagtgatggcgttaccaaagaaaaccactccact
cgcgacgaccgcgacgtccgacgcgtcgtcgtctgcaccgggaagatgttctacgcgctg
cagcaagcgcgtaaacgacgcgggctcgagaaggaaatcgcgctcgtgcgcgtggaacag
ctggcgccgttccctcacggcgcgctcgcgtcgcgcctgggtaaataccccgacgcggag
atcgtgtggtgccaagaggagccgaagaacatggggtggtggccgttcgtgcagccgcgc
ataaacaccgcggtgcgggatcttctcctcggcggcggcggcgggcggacggcgcggtac
gtcgggcggccgtccacggcgtcgcccgcgacgggtagtcagtcgattcacgcgctggag
atgaagagcatcgtgcaggaggcgttgcggggggtcacggagtttccgacgaaatacgcg
ggaccgtacgggggcggcggcggcggcgggtga

DBGET integrated database retrieval system