KEGG   Micromonas pusilla: MICPUCDRAFT_20445Help
Entry
MICPUCDRAFT_20445 CDS       T02696                                 

Gene name
DPE2
Definition
glycoside hydrolase family 77 protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mpp  Micromonas pusilla
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUCDRAFT_20445 (DPE2)
Enzymes [BR:mpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MICPUCDRAFT_20445 (DPE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 742 aa AA seqDB search
MSPSRELATTPEAAAASKASPYDDTPRTETPARVLGPRRAKTPSRIIVRDGHFRHPRAWR
GSGVAVPVFSLRSRESVGAGDFGDLEALVDVAAEAGMSVVQLLPVNDTTVHNTWWDSYPY
SSVSVHALHPLYLKLKPLVEEAANAAAAGPDAGRLMALSAEVDRAKHALDLKEIDYEATM
RVKLMVAKRCFEATRATFLASEACERFVREQASWLKPYAVFSALRELFGTAEHWRWGDLS
ATNAAAVVARLSQPNSELYHVVSMHYYVQYHLDRQLRRAAAHAAARGVVLKGDLPIGVDK
ASVDTWMHPKLFRMNTSTGAPPDDFDPNGQNWGFPTYDWEEMSKDNYAWWRGRMTHLERF
FSAMRIDHVLGFFRIWELPAHTKTGRLGRFRPSVPIRKRELDERGLWFVDRLCEPWVTSE
RLRALFGDRDGEAAGRFFEETGAETKPDGTTSTTYKFRKEYNTERGLLSSEALRVRDGSP
DWLVKETEELRRGLMTLLQNVILLRDPDDADAFYPRIEFEKTTSFRDLDDWARDALSWLY
DDYFNARQDATWRENARRTLPALMSCTGQLVCGEDLGMVPPCVPPVLEELGILGLRIQRM
PHDGGEFGRPERYPYETVCSPSCHDTSTTRAWYEADPARRDRYAKLVSAPEKCEPHVMRA
IVRQHMASPSSIAIFPAQDLLALVGEYATRPAEEETINDPTNPKHYWRFRLHVRLEDMLA
NKAWLGEIRQLVVEGGRMPMTG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgtcgcgcgagctcgcgaccaccccggaggcggcggcggcgtccaaggcgtcg
ccgtacgacgacacgccgcgcaccgagacgcccgcgcgcgtcctcggcccgcgacgcgcg
aagacgccgtcgcggatcatcgtcagggacgggcacttccggcacccgcgcgcgtggcgc
ggcagcggcgtcgccgtgccggtgttctccctgcgatcgcgagagagcgtcggcgcgggc
gatttcggcgacttggaagcgctcgtggacgtcgccgcggaggcggggatgagcgtcgtg
cagctcctgccggtgaacgacacgaccgtgcacaacacgtggtgggactcgtacccgtac
agcagcgtctccgtgcacgcgttgcacccgttgtacttgaagctcaagccgctcgtagag
gaggcggctaatgcggcggcggcgggccccgacgccggccgtttgatggcgctcagcgcg
gaggtggatcgcgcgaagcacgcgctcgatctcaaagagatcgactacgaggcgacgatg
cgcgtgaagctgatggtcgcgaagcggtgcttcgaggcgacgcgggcgacgtttttggcg
tccgaggcgtgcgagcgcttcgtccgcgagcaggcgtcgtggttgaaaccctacgcggtg
ttcagcgcgctgcgggagctcttcgggaccgcggagcactggcggtggggcgacttgtcc
gcgacgaacgcggccgcggtcgtcgcgcgtctgtcgcagccgaacagcgagctgtaccac
gtcgtgtcgatgcactactacgtgcagtaccacctcgaccggcagttgcgccgggcggct
gcgcacgcggcggcgcggggcgtcgtgttgaagggcgacctgcccatcggcgtggataag
gcgtccgtggacacgtggatgcacccgaaactgttccggatgaacacgagcacgggggct
ccgccggatgacttcgacccgaacggccagaactggggtttccccacgtacgattgggag
gagatgagcaaggacaactacgcgtggtggcggggccggatgacgcacctggagcgtttt
ttcagcgcgatgcggatcgaccacgtgttgggtttcttccggatctgggagctccccgcg
cacacgaaaacgggtcgcctcggacggtttcgtccgtccgtgccgattcggaaacgcgag
ctcgacgagagagggctgtggttcgtcgaccgcctgtgcgagccgtgggtgacgtccgag
cggttgcgagcgctcttcggcgaccgcgacggcgaagccgcggggaggttcttcgaagag
accggcgctgagacgaagccggacggcaccacgtcgacgacgtacaagttcaggaaggag
tacaacaccgagagagggctcctgagctcggaggcgttgcgcgtccgcgacgggtccccg
gattggctcgtgaaggagacggaggagctgcgacgcggcttgatgacgctcctgcagaac
gtcatcctgctccgcgacccggacgacgcggacgcgttttacccgcggatcgaattcgaa
aagacgacgagtttccgcgatctcgacgactgggcgcgagacgcgctctcgtggctgtac
gacgactacttcaacgcgaggcaagacgcgacgtggcgggagaacgcgcggcggacgctg
ccggcgctgatgtcgtgcaccgggcagctcgtgtgcggggaggatctcgggatggtcccg
ccgtgcgtcccgcccgtgctcgaagagctcgggatcttggggctgcgcatacagcggatg
ccgcacgacggcggcgagttcggccggccggagcgctacccgtacgagaccgtgtgcagc
ccctcatgtcacgacacgtccacgactagggcgtggtacgaggcggacccggcgcgacgg
gatcggtacgcgaagctcgtctccgcgccggagaagtgcgagccgcacgtgatgcgggcg
atcgtgcggcagcacatggcgagcccgtcgtccatcgcgatattccccgcgcaggatctc
ctcgcgctcgtgggggagtacgcgacgcgaccggcggaggaggagacgatcaacgacccg
acgaacccgaagcattactggcggttcaggctgcacgtgaggttggaggacatgctcgcg
aataaggcgtggctgggggagattcggcagctcgtcgtcgagggtggacggatgccgatg
accgggtga

DBGET integrated database retrieval system