KEGG   Micromonas pusilla: MICPUCDRAFT_21290Help
Entry
MICPUCDRAFT_21290 CDS       T02696                                 

Gene name
BAM1
Definition
glycoside hydrolase family 14 protein
Orthology
K01177  
beta-amylase [EC:3.2.1.2]
Organism
mpp  Micromonas pusilla
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mpp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 546 aa AA seqDB search
MYSRDVLDGDHFPIVHDFSYAASPTPVFVMLPLDVVTRDGVLQHGKALEVSLKTLKKIGV
EGVMIDVWWGIVERDGPGSYDWDAYLTLMEMVSNAGLKLNAVMSFHACGANVGDYFEVKL
PGWVLEAAVDDPDLFFTDQYGYRNPEVISLWADNAKTLEGRTPLECYGDFMRSFRDSVEA
AGLTETLSEISVGCGPCGELRYPAYPENKQRQQSSQWQFPGIGEFQARSISHWFPYDRCY
DQRALGNLARAGSEAGHIEWGGAGPHDAGGYNNLPHETGFFRAHLGSWDTEYGQFFLSWY
SGELVEHGDRMLQCARGVFGASDDGVQLALKCAGVHWWYNSRSHAAELTAGYFNTRSGDY
APERDGYEPIVKICAKHEARLNFTCAEMRDIEHPFFSRCGPEGLLRQIRAAAGRHGVKVA
GENALCRFDQDAYDKIITNCRGEGNESARWESGALLPPMASFTFLRMTRELFEDDNFNSF
VHFVTRMANETGVDVDGAEGGERTRELVKPERVMESLHRSAGGLNLHDLRQETASGLVAA
QFSDHI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgtactccagagacgtcctggacggcgaccactttccgatcgtgcacgacttttcatac
gccgcgtcgccgacgcccgtcttcgtcatgctgcccctcgacgtggtcacgcgcgatggc
gtcctacaacacggcaaggcgctcgaggtgagcctcaagacgctgaagaagattggcgtc
gagggcgtgatgatcgacgtgtggtgggggatcgtcgaacgcgacggcccggggtcgtac
gactgggacgcgtacttgaccctgatggagatggtttcaaacgccgggttgaagctcaac
gcggtgatgtcgtttcacgcgtgcggcgccaacgtcggcgattacttcgaggtgaagctc
cccgggtgggtcctcgaggccgccgtggacgacccggacctgttcttcacggaccagtac
gggtaccgcaacccggaggtcatctcgttgtgggcggacaacgcgaagacgctcgagggg
cggacgccattggaatgctacggcgacttcatgcggagctttcgagattcggtagaggcg
gcggggctgacggagaccctctcggagatctccgtcggctgcgggccgtgcggcgagctt
cgatacccggcgtacccggagaacaagcagcgccagcagtcgtcgcagtggcagttcccc
ggcatcggcgagtttcaggcgcgttctatctcacactggttcccatacgaccgctgctac
gaccagcgcgcgcttggaaatctcgcgcgcgcggggagcgaggctggccacatcgagtgg
ggcggcgcggggccgcacgacgcgggcgggtacaacaacctcccgcacgagaccgggttc
ttccgcgcgcacctcgggtcgtgggacacggagtacgggcagtttttcctctcctggtac
agcggcgagctcgtggagcacggcgatcggatgctgcagtgcgcgcgcggcgttttcggc
gccagcgacgacggcgtacagctggcgctgaaatgcgcgggggtgcactggtggtataac
tcgaggtcgcacgccgcggagctcaccgcggggtacttcaacacgcggagcggggactac
gcgccggagcgggacgggtacgagccgatcgtgaagatttgcgcgaagcacgaggcgagg
ctgaactttacgtgcgcggagatgcgagacatcgagcatcccttcttttcgcgctgcggg
ccggagggactgcttcgacagattcgcgccgccgcggggcggcacggcgtcaaggtggcg
ggcgagaacgcgctgtgtcgcttcgaccaggacgcgtacgataagatcatcacgaactgc
cgcggggaagggaacgagagcgcgcggtgggagtcgggcgcgcttctgccgccgatggct
tcgtttacgtttcttcgcatgacgcgcgagctcttcgaggatgacaacttcaactcgttc
gtgcacttcgtcacgaggatggcgaacgagacgggcgtggacgtcgacggcgcggaaggg
ggcgagcggacgagagagctcgtgaagccagagcgcgtcatggagtcgctgcatcgaagc
gcgggcgggttgaacctgcacgacttgaggcaagagacggccagcgggctcgttgccgcg
cagttttcagatcatatttga

DBGET integrated database retrieval system