KEGG   Micromonas pusilla: MICPUCDRAFT_25831Help
Entry
MICPUCDRAFT_25831 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MICPUCDRAFT_25831
Peptidases [BR:mpp01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MICPUCDRAFT_25831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 339 aa AA seqDB search
MDWTTIESDPGVFTELIQEMGVKGVQVEELYALDEDLLKSMAPVYGLIFLFKWRSGDPPS
APVETDANANGVFFASQVITNACATQAILSILMNCPPSVTLGAELANMKEFTAEFDADLK
GLAISNSETIRKAHNSFARPEPIMEPEREAKKDDDVFHFIAYMPVNGVLYELDGLKKGPI
SHGACTDDDWMGKACPVIQSRIEKYASSEIRFNLMALIKSKRDALEERAQTLEGRKQRCL
SALGGGGGGGGGEGMDVDDPDGPLPVGDDALNAEVARIEVEIARSRGEVEAELERRGRWR
DENIRRKHNYIPFIFNFLKVLAEKKKLEPLIEKARGKGA
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggattggacgacgatcgagagcgaccccggggtcttcaccgagctcatccaggagatg
ggggtgaagggcgtgcaggtcgaggagctgtacgcgctcgacgaggacctgctcaagtcc
atggctcccgtgtacggcctcatcttcctgttcaaatggcgcagcggcgatcccccgagc
gcgccggtggagacggacgcgaacgcgaacggcgtcttcttcgcgagccaggtcatcacg
aacgcgtgcgcgacgcaggcgatcctgtccatcctgatgaactgcccgccgagcgtcacg
ctcggcgcggagctcgcgaacatgaaggagttcaccgcggagttcgacgcggacttgaaa
gggctcgccatctcgaacagcgagacgattcgcaaggcgcacaactcgttcgcgcgcccg
gagcccatcatggagcctgagagggaggcgaaaaaagacgacgacgtgtttcacttcatc
gcgtacatgcccgtgaacggcgtcttgtacgagctcgacggcctgaagaaagggccgata
tcgcacggcgcgtgcacggacgacgattggatggggaaggcgtgcccggtgattcagtcc
cggatcgaaaagtacgcctcgagcgagattcgattcaatctcatggcgttgatcaagagc
aagcgagacgcgctggaggaacgcgctcagaccttggagggacggaagcagcggtgtctc
agcgcgttaggcggcggcggcggcgggggcggcggcgaggggatggacgtcgacgacccg
gacggcccgctgccggtcggggacgacgcgctgaacgcggaggtggcgaggatagaagtc
gagatcgcgcgatcgagaggggaggtggaggcggagctggagcggcgggggcggtggcgg
gacgagaacatccgtcggaagcacaactacatcccgttcatctttaactttctcaaggtg
ctcgcggagaagaagaagctggagccgctcatcgagaaggcgcggggtaagggcgcgtga

DBGET integrated database retrieval system