KEGG   Micromonas pusilla: MICPUCDRAFT_26376Help
Entry
MICPUCDRAFT_26376 CDS       T02696                                 

Gene name
AMY2
Definition
glycoside hydrolase family 13 protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mpp  Micromonas pusilla
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MICPUCDRAFT_26376 (AMY2)
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MICPUCDRAFT_26376 (AMY2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 431 aa AA seqDB search
MLQGFHWTSCEGGLDGRTWYAELRASIPELVKTGVNVVWLPPPSQSVSAEGYLPQSLYDL
NTPYGSERELRELIAALNAAGIAPMADVVINHRCADTQDENGKWRIFSNANFPAYTWGPW
AIVKDDPCFEGEGNMDTGDVFDAAPDLDHANARVRGELTTWLRWLRDDVGFAAWRFDYAR
GYAAKYAKAYAADTTSLRAMNVAEYWPEATWEEDGTLATCQNPMRQSMCDWLDAADGACA
AFDFATKAVLQEAVSRGEYWRLRDADGKPPGLMGWWPQRAVTFIDNHDTGGNGGGGHWRF
PPEHRVLGYAYILSHPGMPCLFWPHAVRMPDDSGGDMAADIARLCAIRREVGIQADSAIT
IVLAEADMYVARIEGAHAELAVKLGPRYDLPEEILPATDVWTLLTSGEGYALWSRPKRSS
KPRNLEEELSR
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaggtttccactggacgtcgtgcgagggcgggctcgacggccggacgtggtac
gcggagctccgcgcgtcgatcccggagctcgtgaagacgggcgtgaacgtcgtgtggctc
ccgccgccgtcgcagtccgtcagcgcggaggggtacctcccgcagtcgctctacgatctc
aacacgccgtacggatccgagcgcgagctgcgggagctgatcgcggcgctgaacgccgcg
gggatcgcgccgatggctgacgtggtcatcaaccaccggtgcgcggacacgcaggacgag
aacgggaagtggcggatattctcgaacgcgaacttcccggcgtacacgtggggcccgtgg
gcgatcgtgaaggacgacccgtgcttcgaaggcgaggggaacatggacaccggggacgtc
ttcgacgccgcgccggacttggaccacgcgaacgcgcgcgtgcgaggagagctcacgacg
tggctgagatggctccgcgacgacgtcgggttcgccgcgtggcggttcgactacgcgcgc
gggtacgcggcgaagtacgccaaggcgtacgccgcggacacgaccagcctacgcgcgatg
aacgtcgcggagtactggccggaggcgacgtgggaggaggatgggacgctcgcgacgtgc
cagaacccgatgcggcagagcatgtgcgattggctcgacgccgcggacggcgcgtgcgcg
gcgtttgatttcgccacgaaagcggtgctgcaagaggcggtgagtcgcggggagtactgg
cggttacgcgacgcggacgggaaacccccggggttgatgggatggtggccgcagcgcgcg
gtgacgttcatcgataaccacgacacgggcgggaacggcggcggcggacactggcggttc
cctcccgagcaccgcgtgctggggtacgcgtacatcctgtcccaccccgggatgccgtgc
ctcttttggccgcacgccgtgcgcatgccggacgacagcggcggggacatggccgcggac
atcgcgaggctgtgcgcgatccgccgcgaggtcgggatccaagcggacagcgcgataacg
atcgtgctcgcggaggcggacatgtacgtcgcgaggatagagggcgcgcacgcggagctg
gcggtgaagttggggccgaggtacgacttgcccgaggagatcttacccgcgacggacgtg
tggacgctgctgacgagcggcgaggggtacgcgctgtggagtcgtccgaagcggagtagt
aagcctcgaaacttagaggaggagctctcgcggtga

DBGET integrated database retrieval system