KEGG   Micromonas pusilla: MICPUCDRAFT_30966Help
Entry
MICPUCDRAFT_30966 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
mpp  Micromonas pusilla
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mpp01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mpp00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 464 aa AA seqDB search
MSTTREKAVAARAASRQLQNLSSDERAELLNRIADALEANEPAILRENELDLKKAAEDGT
EPALMNRLKMKPGKIAQLAEGARQIARMEEPLVRPLSKMELADGLMLEQVTAPLGVLLII
FESRPDALPQIAALSIRSGNGLLLKGGKEAAKTNAILHRVIVECFPQFGVAKEAIVLVEG
RAEIADILKLNDVVDLVIPRGSNDLVTYIQDNTKIPVLGHADGVCHVYVDPDADIDMACK
LCVDSKCDYPAACNALETLLVHSSQLGAGGGYERVAAALDAAGVEKFGGARAAKELSLPP
CPALRHEYGTLALTVEIVDSMDEAIEYIHANGSSHTDCIITKDKARAEEFLRRVDSACVF
HNASTRFSDGFRFGLGAEVGISTSRIHARGPVGVEGLLTTRWLLRGKGQYSDKDTAVTYT
HKKISIGGAWIKRAAEGITAAVGVVNAVNIGLMILAWKKGSGKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacgcgcgagaaggctgtcgccgcgcgcgcggcgtctcgccagctccagaat
ctgtcgtccgacgagcgcgcggagctcctgaaccgaatcgcggacgcgctcgaggcgaac
gagcccgccatcctgcgcgagaacgagctcgacctgaagaaagccgcggaggacggcacc
gagccggcgctgatgaaccgcctgaagatgaagcccgggaagatcgcgcagctcgcggag
ggggcgcgtcagatcgcgcgcatggaggaacccctcgtgcgcccgctgtcgaagatggaa
ctcgcggacgggctgatgctcgagcaggtcaccgcgccgctcggcgtgctcttgatcatc
ttcgagtcgcgcccggacgcgctgccgcagatcgctgcgctgtcgatccggtccgggaac
ggcctcctcctcaagggcggcaaggaggcggcgaagacgaacgcgatcctgcatcgcgtc
atcgtggagtgctttccgcaattcggcgtcgcgaaagaagcgatcgtcctcgtcgaaggc
cgcgcggagatcgcggacatcctcaagctcaacgacgtcgtcgacctcgtcatcccgcgc
gggagcaacgacctcgtgacgtacatccaagacaacacgaagatccccgtgctcgggcac
gcggatggcgtgtgtcacgtgtacgtagacccggacgcggacatcgacatggcgtgcaag
ctgtgcgtcgacagcaagtgcgactacccggccgcgtgcaacgcgctggagacgcttctc
gtgcactcgtcgcagctcggcgcggggggggggtacgagcgcgtcgccgccgcgctcgac
gccgcgggcgtggagaagtttggcggcgcgcgcgcggcgaaagagctctcgctgccgccg
tgcccggcgcttcgacacgagtacggcaccctcgcgctcaccgtggagatcgtcgactcc
atggacgaggcgatcgagtacatccacgcgaacgggtcgtcgcacacggactgcatcatc
acgaaggataaggcgcgcgcggaggagtttttacgcagggtggactccgcgtgcgtgttc
cacaacgcgtccactcggttcagcgacgggttccggttcggtctgggcgcggaggttggc
atctccacgtcgcgcatacacgcgcgcgggcccgtcggcgtggaagggttgctcacgacg
aggtggctgttgcgagggaaagggcagtacagcgataaggacacggcggtgacgtacacg
cacaagaagatttcaatcggcggcgcgtggatcaaacgcgcggcggaggggatcaccgcg
gcggtcggcgtcgtgaacgcggtgaacatcggcctcatgattctcgcgtggaagaaaggg
tcggggaagaagtga

DBGET integrated database retrieval system