KEGG   Micromonas pusilla: MICPUCDRAFT_30966Help
Entry
MICPUCDRAFT_30966 CDS       T02696                                 

Definition
hypothetical protein
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
mpp  Micromonas pusilla
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MICPUCDRAFT_30966
  Amino acid metabolism
   00330 Arginine and proline metabolism
    MICPUCDRAFT_30966
Enzymes [BR:mpp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     MICPUCDRAFT_30966
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MICPUCDRAFT_30966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 464 aa AA seqDB search
MSTTREKAVAARAASRQLQNLSSDERAELLNRIADALEANEPAILRENELDLKKAAEDGT
EPALMNRLKMKPGKIAQLAEGARQIARMEEPLVRPLSKMELADGLMLEQVTAPLGVLLII
FESRPDALPQIAALSIRSGNGLLLKGGKEAAKTNAILHRVIVECFPQFGVAKEAIVLVEG
RAEIADILKLNDVVDLVIPRGSNDLVTYIQDNTKIPVLGHADGVCHVYVDPDADIDMACK
LCVDSKCDYPAACNALETLLVHSSQLGAGGGYERVAAALDAAGVEKFGGARAAKELSLPP
CPALRHEYGTLALTVEIVDSMDEAIEYIHANGSSHTDCIITKDKARAEEFLRRVDSACVF
HNASTRFSDGFRFGLGAEVGISTSRIHARGPVGVEGLLTTRWLLRGKGQYSDKDTAVTYT
HKKISIGGAWIKRAAEGITAAVGVVNAVNIGLMILAWKKGSGKK
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccacgcgcgagaaggctgtcgccgcgcgcgcggcgtctcgccagctccagaat
ctgtcgtccgacgagcgcgcggagctcctgaaccgaatcgcggacgcgctcgaggcgaac
gagcccgccatcctgcgcgagaacgagctcgacctgaagaaagccgcggaggacggcacc
gagccggcgctgatgaaccgcctgaagatgaagcccgggaagatcgcgcagctcgcggag
ggggcgcgtcagatcgcgcgcatggaggaacccctcgtgcgcccgctgtcgaagatggaa
ctcgcggacgggctgatgctcgagcaggtcaccgcgccgctcggcgtgctcttgatcatc
ttcgagtcgcgcccggacgcgctgccgcagatcgctgcgctgtcgatccggtccgggaac
ggcctcctcctcaagggcggcaaggaggcggcgaagacgaacgcgatcctgcatcgcgtc
atcgtggagtgctttccgcaattcggcgtcgcgaaagaagcgatcgtcctcgtcgaaggc
cgcgcggagatcgcggacatcctcaagctcaacgacgtcgtcgacctcgtcatcccgcgc
gggagcaacgacctcgtgacgtacatccaagacaacacgaagatccccgtgctcgggcac
gcggatggcgtgtgtcacgtgtacgtagacccggacgcggacatcgacatggcgtgcaag
ctgtgcgtcgacagcaagtgcgactacccggccgcgtgcaacgcgctggagacgcttctc
gtgcactcgtcgcagctcggcgcggggggggggtacgagcgcgtcgccgccgcgctcgac
gccgcgggcgtggagaagtttggcggcgcgcgcgcggcgaaagagctctcgctgccgccg
tgcccggcgcttcgacacgagtacggcaccctcgcgctcaccgtggagatcgtcgactcc
atggacgaggcgatcgagtacatccacgcgaacgggtcgtcgcacacggactgcatcatc
acgaaggataaggcgcgcgcggaggagtttttacgcagggtggactccgcgtgcgtgttc
cacaacgcgtccactcggttcagcgacgggttccggttcggtctgggcgcggaggttggc
atctccacgtcgcgcatacacgcgcgcgggcccgtcggcgtggaagggttgctcacgacg
aggtggctgttgcgagggaaagggcagtacagcgataaggacacggcggtgacgtacacg
cacaagaagatttcaatcggcggcgcgtggatcaaacgcgcggcggaggggatcaccgcg
gcggtcggcgtcgtgaacgcggtgaacatcggcctcatgattctcgcgtggaagaaaggg
tcggggaagaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system