KEGG   Micromonas pusilla: MICPUCDRAFT_31447Help
Entry
MICPUCDRAFT_31447 CDS       T02696                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mpp  Micromonas pusilla
Brite
Enzymes [BR:mpp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MICPUCDRAFT_31447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 531 aa AA seqDB search
MAGKAKISYFYDPDVGNFYYGQGHPMKPHRVRMTHNLLLHYGVYKEMELFRPALASAEDM
TQFHSDEYIEFLRLITPDNQHEHMRQLKRFNCAEDCPVFDGLFNFCQIYTGGSVGGAVRL
NHKQTDTVVNWAGGLHHAKKNEASGFCYVNDIVLAILELLKVHQRVLYIDIDIHHGDGVE
EAFYTTDRVMTVSFHKFGEYFPGTGHLQDIGQHKGKHYSVNVPLKDGIDDESYNMLFKPV
MAKVMEMYAPDAVVFQSGADSLTGDRLGCFNLSIRGHAECLKYMMTFNVPLLVLGGGGYT
IRNVARCWTYETGCLLGHELDDKMPVNDYSEYYGPTHTLQISPSNMENQNTPEYLEGVRN
RILENLSKIAPKPSVPFHDVPPDAITQEAQEVKEDPDAKGGGAEAEASRRAHHSELEPGE
GDRDDRPSRQDHDTRDMNTVTTYEPGSHKFEDAIKDEEDASDVDAIAELGDAAAAGDPGE
DADAKVKTTNCDELVLDRDYADGGLGRDDSDELDRAPSVLPGIILNDHDGQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcaaggcgaagatctcgtatttttacgatccggacgtcggtaacttttactac
ggtcaaggtcacccgatgaagccccaccgcgtccgcatgacgcacaacctacttcttcat
tatggcgtatacaaggagatggagctgttccgtcccgccctcgcttccgcggaggacatg
actcagttccactctgacgagtacatcgaattcttacggttgataaccccggacaaccag
cacgaacacatgaggcaactgaaacgattcaactgtgcggaggattgtcccgtgttcgat
ggattgttcaacttttgccaaatctacaccggtgggagcgtaggaggggcggtgcgtttg
aatcacaagcaaactgacacggtcgttaattgggctggtggattgcaccacgcaaagaag
aacgaagcgtccgggttttgttacgttaacgacatcgtgctcgccattctcgagcttctt
aaagtccatcaacgcgtgttgtatatcgatatcgatattcatcatggcgacggtgtggaa
gaagctttttacaccaccgatcgcgtaatgacagtttcgtttcacaagttcggcgagtat
ttccctggcaccggtcaccttcaagacattgggcagcacaaggggaagcattacagcgta
aatgttccgctcaaggacggcatcgacgatgaatcatacaatatgcttttcaaacctgtc
atggcgaaagtgatggagatgtatgctccggatgcagtcgtatttcagtccggcgcagat
tccttgacaggagatcgccttggctgcttcaaccttagcatccgaggacacgcggagtgt
cttaagtatatgatgaccttcaatgtgcctttacttgtgttaggcggcggcgggtatacg
atccgaaacgtcgcgcggtgttggacttacgagacagggtgtcttcttggtcacgagctc
gatgataagatgccggtgaacgactacagcgaatattatggccccacgcatacgctgcaa
atatcgccttcgaacatggagaaccaaaacacgccagagtacctcgaaggcgtgcggaac
cgtattttggagaacctctcaaaaatcgcacctaaaccgtccgttccttttcacgatgtt
cccccagatgcgatcactcaagaggcacaggaggtgaaggaagacccggatgcaaaaggt
ggtggtgcagaggcggaagcatccagaagagcgcatcactccgagctcgagccgggcgag
ggagatcgcgatgacagaccatcacgtcaggaccacgacacgcgcgacatgaacactgta
actacatacgagccaggctctcataaatttgaggacgctatcaaggatgaagaagatgca
tcggatgttgatgcgatagctgagctcggagatgcagctgctgctggcgatccgggtgaa
gacgctgatgcaaaggtgaaaacgacgaattgtgatgagttggttctcgacagagactat
gccgacggaggtctaggtcgcgacgacagcgatgaacttgatcgggcaccttcggtcttg
cctgggataattttgaacgaccacgacggtcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system