KEGG   Micromonas pusilla: MICPUCDRAFT_34341Help
Entry
MICPUCDRAFT_34341 CDS       T02696                                 

Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mpp  Micromonas pusilla
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 430 aa AA seqDB search
MAPSKDRISYFYDADVGTSYYGNNHPMKPHRLAMTHHLVLSYDLHKKMEVYRPRRSYPVE
MSQFHAEDYVDFLSRITPDTQQDHTEQMQRYNLGEDCPIFDGLFDFCKLYTGGSIDGAVR
LNHGLSDIAINWSGGLHHAKKSEASGFCYINDLVLAILELLKHHPRVLYIDIDIHHGDGV
EEAFYLTDRVMTVSFHKYGDMFFPGTGALKDVGGDAGKYYSVNVPLLDGMDDAGFRAIFK
SVMQKVMDVYQPGAVVLQCGADSLAADRLGCFNLTLDGHADCVKFMKRFNVPLLVTGGGG
YTKSNVARCWTYETAALLDKTLSTDIPEHDFYYEYYADVGYKMKVQPTNYIENLNTKTYL
QDVKQQVMENLRALEHAPGVGMHEVPPDSMIPEFDEDELNPDERYGGAAGMDKLVFGDDE
FYEDDKDQDR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgagcaaggaccgcatctcctacttctacgacgcggacgttgggacgtcgtac
tatgggaacaatcacccgatgaagccgcatcgtctcgcgatgacgcatcacctcgtgctg
tcgtacgatctgcacaagaagatggaagtctaccgcccgcgtcggtcgtaccccgtggag
atgtcgcagttccacgcggaagattacgtggatttcctctctcgcatcaccccagacacg
caacaggaccacaccgagcagatgcaacggtataacctcggcgaggactgccccatattc
gacggtctgtttgacttttgcaagctgtacacgggcgggagcatcgacggcgcggtgcga
ttgaaccacggcctcagcgacatcgcgatcaactggtccggggggttacaccacgcgaag
aagtcggaggcgtccgggttctgttacatcaacgatttagtcctcgcgatcctcgaactc
ctgaagcatcacccgagggttctgtacatcgacatcgacatccaccacggcgacggcgtg
gaagaagctttttatttaaccgacagagtcatgaccgtgtcgttccacaagtacggcgac
atgttcttccccggcaccggcgcgctcaaagacgtcggcggcgacgcggggaaatattac
agcgtcaacgtccctctcctagacggcatggacgacgccgggtttagggccatcttcaag
tccgtgatgcagaaagtcatggacgtgtaccagcccggcgcggtcgtgcttcagtgcggc
gcggactcgctcgcggcggacaggttaggatgcttcaacctgacgttggacggacacgcg
gactgcgtgaagtttatgaagcggttcaacgtgcctctgctggtgacgggcggcggcggg
tacacgaagtccaacgtcgcgcggtgctggacgtacgagaccgcggcgcttctggacaag
acgttgtccacggacatcccggagcacgatttctactacgagtactacgcggacgtgggg
tataagatgaaggtgcagccgacgaattacatcgaaaacttgaacacgaagacgtacctg
caggacgtaaagcagcaggtgatggagaacttgcgcgcgttggagcacgcgccgggggtg
gggatgcacgaggttccgccggactcgatgatcccggagtttgacgaggacgagttgaac
ccggacgagaggtacggcggcgcggcgggaatggacaagttggtcttcggcgacgacgaa
ttttacgaggacgacaaggaccaagaccggtga

DBGET integrated database retrieval system